Glucagon-like peptide 1 receptor agonist ZP10A increases insulin mRNA expression and prevents diabetic progression in db/db mice
…, S Neve, BD Larsen, E Meier, JS Petersen - … of Pharmacology and …, 2003 - ASPET
We characterized the novel, rationally designed peptide glucagon-like peptide 1 (GLP-1)
receptor agonist H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH 2 (…
receptor agonist H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH 2 (…
Pharmacological characterization of the new stable antiarrhythmic peptide analog Ac-D-Tyr-D-Pro-D-Hyp-Gly-D-Ala-Gly-NH2 (ZP123): in vivo and in vitro studies
…, CB Knudsen, T Jepsen, BD Larsen, JS Petersen - … of Pharmacology and …, 2003 - ASPET
Antiarrhythmic peptides (AAPs) are a group of compounds with antiarrhythmic properties;
however, their use has been hampered by very low plasma stability. The aim of this study was …
however, their use has been hampered by very low plasma stability. The aim of this study was …
The antiarrhythmic peptide analog ZP123 prevents atrial conduction slowing during metabolic stress
…, KB Olsen, L Hartvig, JS Petersen… - Journal of …, 2005 - Wiley Online Library
Objective: As atrial conduction slowing is important in the pathogenesis of atrial reentry
arrhythmias, a drug that increases atrial conduction or prevents atrial conduction slowing could …
arrhythmias, a drug that increases atrial conduction or prevents atrial conduction slowing could …
Decreased vasopressin-mediated renal water reabsorption in rats with compensated liver cirrhosis
…, S Christensen, JS Petersen - American Journal of …, 1998 - journals.physiology.org
Experiments were performed to investigate vasopressin type 2 receptor (V 2 )-mediated renal
water reabsorption and the renal expression of the vasopressin-regulated water channel …
water reabsorption and the renal expression of the vasopressin-regulated water channel …
Atrial fibrillation in rats induced by rapid transesophageal atrial pacing during brief episodes of asphyxia: a new in vivo model
…, HR Lam, CB Knudsen, JS Petersen - Journal of …, 2004 - journals.lww.com
Non-pharmacological in vivo models of atrial fibrillation (AF) have been developed in large
animals only. We aimed to develop and characterize a new small animal non-…
animals only. We aimed to develop and characterize a new small animal non-…
Treatment with the gap junction modifier rotigaptide (ZP123) reduces infarct size in rats with chronic myocardial infarction
…, MS Nielsen, JK Hennan, JS Petersen - Journal of …, 2006 - journals.lww.com
Abstract Treatment with non-selective drugs (eg, long-chain alcohols, halothane) that reduce
gap junction intercellular communication (GJIC) is associated with reduced infarct size after …
gap junction intercellular communication (GJIC) is associated with reduced infarct size after …
The antiarrhythmic peptide analog rotigaptide (ZP123) stimulates gap junction intercellular communication in human osteoblasts and prevents decrease in femoral …
…, JEB Jensen, OH Sørensen, JS Petersen - …, 2005 - academic.oup.com
Gap junctions play an important role in bone development and function, but the lack of
pharmacological tools has hampered the gap junction research. The antiarrhythmic peptides …
pharmacological tools has hampered the gap junction research. The antiarrhythmic peptides …
Pharmacodynamic characterization of ZP120 (Ac-RYYRWKKKKKKK-NH2), a novel, functionally selective nociceptin/orphanin FQ peptide receptor partial agonist with …
…, E Meier, MM Vinge, C Quist, JS Petersen - … of Pharmacology and …, 2005 - ASPET
In conscious rats, intravenous (iv) administration of the hexapeptide Ac-RYYRWK-NH 2 , a
partial agonist of the nociceptin/orphanin FQ (N/OFQ) peptide (NOP) receptor, produces a …
partial agonist of the nociceptin/orphanin FQ (N/OFQ) peptide (NOP) receptor, produces a …
Increasing gap junctional coupling: a tool for dissecting the role of gap junctions
…, JK Hennan, NH Holstein-Rathlou, JS Petersen… - Journal of membrane …, 2007 - Springer
Much of our current knowledge about the physiological and pathophysiological role of gap
junctions is based on experiments where coupling has been reduced by either chemical …
junctions is based on experiments where coupling has been reduced by either chemical …
AT1 and AT2 Receptor Blockade and Epinephrine Release During Insulin-Induced Hypoglycemia
RH Worck, E Frandsen, H Ibsen, JS Petersen - Hypertension, 1998 - Am Heart Assoc
Angiotensin II facilitates epinephrine release during insulin-induced hypoglycemia, and this
effect appears to be independent of type 1 angiotensin II (AT 1 ) receptors in man. In the …
effect appears to be independent of type 1 angiotensin II (AT 1 ) receptors in man. In the …