Skip to main content
Advertisement

Main menu

  • Home
  • Articles
    • Current Issue
    • Fast Forward
    • Latest Articles
    • Archive
  • Information
    • Instructions to Authors
    • Submit a Manuscript
    • FAQs
    • For Subscribers
    • Terms & Conditions of Use
    • Permissions
  • Editorial Board
  • Alerts
    • Alerts
    • RSS Feeds
  • Virtual Issues
  • Feedback
  • Other Publications
    • Drug Metabolism and Disposition
    • Journal of Pharmacology and Experimental Therapeutics
    • Molecular Pharmacology
    • Pharmacological Reviews
    • Pharmacology Research & Perspectives
    • ASPET

User menu

  • My alerts
  • Log in
  • Log out
  • My Cart

Search

  • Advanced search
Journal of Pharmacology and Experimental Therapeutics
  • Other Publications
    • Drug Metabolism and Disposition
    • Journal of Pharmacology and Experimental Therapeutics
    • Molecular Pharmacology
    • Pharmacological Reviews
    • Pharmacology Research & Perspectives
    • ASPET
  • My alerts
  • Log in
  • Log out
  • My Cart
Journal of Pharmacology and Experimental Therapeutics

Advanced Search

  • Home
  • Articles
    • Current Issue
    • Fast Forward
    • Latest Articles
    • Archive
  • Information
    • Instructions to Authors
    • Submit a Manuscript
    • FAQs
    • For Subscribers
    • Terms & Conditions of Use
    • Permissions
  • Editorial Board
  • Alerts
    • Alerts
    • RSS Feeds
  • Virtual Issues
  • Feedback
  • Visit jpet on Facebook
  • Follow jpet on Twitter
  • Follow jpet on LinkedIn
Research ArticleCARDIOVASCULAR

Immune Cell Regulation and Cardiovascular Effects of Sphingosine 1-Phosphate Receptor Agonists in Rodents Are Mediated via Distinct Receptor Subtypes

M. Forrest, S.-Y. Sun, R. Hajdu, J. Bergstrom, D. Card, G. Doherty, J. Hale, C. Keohane, C. Meyers, J. Milligan, S. Mills, N. Nomura, H. Rosen, M. Rosenbach, G.-J. Shei, I. I. Singer, M. Tian, S. West, V. White, J. Xie, R. L. Proia and S. Mandala
Journal of Pharmacology and Experimental Therapeutics May 2004, 309 (2) 758-768; DOI: https://doi.org/10.1124/jpet.103.062828
M. Forrest
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
S.-Y. Sun
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
R. Hajdu
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
J. Bergstrom
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
D. Card
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
G. Doherty
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
J. Hale
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
C. Keohane
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
C. Meyers
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
J. Milligan
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
S. Mills
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
N. Nomura
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
H. Rosen
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
M. Rosenbach
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
G.-J. Shei
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
I. I. Singer
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
M. Tian
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
S. West
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
V. White
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
J. Xie
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
R. L. Proia
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
S. Mandala
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
  • Article
  • Figures & Data
  • Info & Metrics
  • eLetters
  • PDF
Loading

Abstract

Sphingosine 1-phosphate (S1P) is a bioactive lysolipid with pleiotropic functions mediated through a family of G proteincoupled receptors, S1P1,2,3,4,5. Physiological effects of S1P receptor agonists include regulation of cardiovascular function and immunosuppression via redistribution of lymphocytes from blood to secondary lymphoid organs. The phosphorylated metabolite of the immunosuppressant agent FTY720 (2-amino-2-(2-[4-octylphenyl]ethyl)-1,3-propanediol) and other phosphonate analogs with differential receptor selectivity were investigated. No significant species differences in compound potency or rank order of activity on receptors cloned from human, murine, and rat sources were observed. All synthetic analogs were high-affinity agonists on S1P1, with IC50 values for ligand binding between 0.3 and 14 nM. The correlation between S1P1 receptor activation and the ED50 for lymphocyte reduction was highly significant (p < 0.001) and lower for the other receptors. In contrast to S1P1-mediated effects on lymphocyte recirculation, three lines of evidence link S1P3 receptor activity with acute toxicity and cardiovascular regulation: compound potency on S1P3 correlated with toxicity and bradycardia; the shift in potency of phosphorylated-FTY720 for inducing lymphopenia versus bradycardia and hypertension was consistent with affinity for S1P1 relative to S1P3; and toxicity, bradycardia, and hypertension were absent in S1P3-/- mice. Blood pressure effects of agonists in anesthetized rats were complex, whereas hypertension was the predominant effect in conscious rats and mice. Immunolocalization of S1P3 in rodent heart revealed abundant expression on myocytes and perivascular smooth muscle cells consistent with regulation of bradycardia and hypertension, whereas S1P1 expression was restricted to the vascular endothelium.

Sphingosine 1-phosphate (S1P) is a bioactive lipid derived from metabolism of sphingomyelin (Pyne and Pyne, 2000). S1P has been implicated in the regulation of many cellular functions including proliferation, apoptosis, survival, adhesion, differentiation, and migration (Hla et al., 2001). The diverse signaling has been attributed, in part, to the activation of a family of G protein-coupled receptors called S1P or edg receptors that are differentially expressed and coupled to Gi/o, Gq, and G12/13 proteins (Chun et al., 2002).

Few pharmacological tools with in vivo activity have been described for the S1P receptors, but functions of the individual receptors are beginning to be elucidated. S1P1/edg1 has a widespread distribution and is highly abundant on endothelial cells where it works in concert with S1P3/edg3 to regulate cell migration, differentiation, and barrier function (Lee et al., 1999; Garcia et al., 2001). Although these receptors stimulate some pathways in common, they are not redundant. The S1P1 null embryos are defective in the migration of smooth muscle cell pericytes that are required to support vascular maturation and the embryos die at day 13.5 from hemorrhage (Liu et al., 2000). In contrast, the S1P3 null mouse is phenotypically normal (Ishii et al., 2001). S1P2/edg5 is a potent activator of the Rho pathway and inhibits cell migration, whereas S1P1 and S1P3 stimulate chemotaxis of many cell types (Okamoto et al., 2000; Graeler and Goetzl, 2002). Much less is known about the function of S1P4/edg6, which is restricted to hematopoietic and lymphoid tissues (Graeler et al., 1999), and S1P5/edg8, which is predominant in rodent brain (Im et al., 2000) but more broadly expressed in human tissues (Niedernberg et al., 2002).

A novel physiological role for S1P in immune regulation has been discovered recently by elucidating the mechanism of FTY720 (Brinkmann et al., 2002; Mandala et al., 2002), an immunosuppressive agent with activity in many models of transplantation and immune-based disease (Dumont, 2000; Brinkmann et al., 2001). FTY720 depletes peripheral blood lymphocytes and sequesters them in secondary lymphoid organs (Chiba et al., 1998). We discovered that FTY720 is phosphorylated in vivo to become a high-affinity ligand (Compound A) for S1P1,3,4,5 but not S1P2 (Mandala et al., 2002). A non-hydrolyzable phosphonate analog (Compound B) with similar S1P receptor selectivity was also able to alter lymphocyte recirculation (Mandala et al., 2002). Close analogs of FTY720, such as the (S) enantiomer of 2-amino-4-(4-heptyloxyphenyl)-2-methylbutanol, that were not substrates for phosphorylation did not have immunosuppressive activity, thus providing additional evidence that the phosphorylated metabolite is the active species (Brinkmann et al., 2002; Mandala et al., 2002). The receptor(s) responsible for immune modulation has not been determined, although both S1P1 and S1P4 have been implicated based on their roles in regulating lymphocyte chemotaxis (Brinkmann et al., 2001; Dorsam et al., 2003).

Clinical studies with FTY720 have identified dose-dependent transient asymptomatic bradycardia in stable renal transplant patients (Budde et al., 2002). Although there are no published reports on the effects of FTY720 on heart rate in rodents, S1P decreased heart rate in anesthetized rats (Sugiyama et al., 2000a). Bradycardia is consistent with previous reports of S1P activation of muscarinic receptor-activated inwardly rectifying K+ currents (IK.Ach) and concomitant slowing of sino-atrial node pacemaker activity (Bunemann et al., 1995; Guo et al., 1999). In contrast to observations in rats, S1P administration to a canine isolated heart preparation evoked a sinus tachycardia (Sugiyama et al., 2000b). The effects of S1P receptor agonists on vascular tone and mean arterial pressure (MAP) are similarly complex. FTY720 has not been reported to have any effects on MAP in man. However, FTY720 has been shown to either decrease or increase MAP in anesthetized rats (Tawadrous et al., 2002). On isolated vascular preparations, S1P induced relaxation at low concentrations (10-100 nM) (Dantas et al., 2003) and vasoconstrictor effects at higher concentrations (100 nM to 100 μM) (Bischoff et al., 2000; Tosaka et al., 2001). The complex cardiovascular effects of S1P receptor agonists are likely due to differential effects on S1P receptor subtypes. S1P2 contraction of coronary smooth muscle cells was implicated using a selective antagonist (Ohmori et al., 2003) but antisense to S1P3, not S1P2, inhibited contraction of rat basilar arteries (Salomone et al., 2003). The availability of S1P subtype receptor-selective agonists with in vivo activity that are described in this paper and S1P3 receptor knockout mice allows for a more detailed investigation of the cardiovascular and lymphocyte trafficking effects of S1P agonists.

Materials and Methods

Synthesis of S1P Receptor Agonists. The syntheses of Compounds A and B have been described previously (Mandala et al., 2002). Compound C was prepared in seven steps from 2-acetylamino-2-(2-(4-octylphenyl)ethyl)propane-1,3-dicarboxylic acid, diethyl ester (Durand et al., 2000). Compounds D to F were prepared by reductive amination of the appropriate aryl aldehyde with 3-aminopropylphosphonic acid [Na(CN)BH3, MeOH, 50°C]. All compounds were characterized by 1H NMR, mass spectroscopy, and high-pressure liquid chromatography and were judged to be >95% pure. Detailed procedures are provided in patents WO 03074008 and WO 03062252.

Mouse Lymphocyte Reduction Assay. Mice (three per group) were dosed intravenously with 0.1 ml of test compound dissolved in vehicle [2% (w/v) hydroxypropyl-β-cyclodextrin (Cerestar, Cedar Rapids, IA) and 0.12 M NaCl], and peripheral blood lymphocyte counts were assessed 3 h later. Mice were euthanized via CO2 inhalation, the chest was opened, 0.5 ml of blood was withdrawn via direct cardiac puncture into EDTA, and hematology was evaluated using a clinical hematology AutoAnalyzer calibrated for performing murine differential counts (H2000; CARESIDE, Culver City, CA). Toxicity was observed upon administration of some of the test compounds. Severe signs included death, seizure, paralysis, or unconsciousness. Milder signs were also noted and included ataxia, labored breathing, ruffling, or reduced activity relative to normal. To assess lymphopenic activity with these compounds, upon noting symptoms in the first animal, the dosing solution was diluted in the same vehicle and administered to a second mouse for observation. The process was repeated until a dose was reached that produced only brief, mild symptoms. This was considered the maximum tolerated dose. All procedures were performed in accordance with the highest standards for the humane handling, care, and treatment of research animals and were approved by the Merck Institutional Animal Care and Use Committee.

Receptors and Cell Lines. CHO cells stably expressing human S1P1,2,3,4,5 were as previously described (Mandala et al., 2002). cDNA sequences encoding rodent S1P receptors were cloned from genomic DNA by polymerase chain reaction using the following primers for each respective receptor: 5′-GAACCCGGGTGTCCACTAGCATCCCGG and 5′-CCCGAATTCTTAGGAAGAAGAATTGACGTTTCC (mouse S1P1), 5′-GAACCCGGGCGGCTTATACTCAGAGTACC and 5′-GGCGAATTCTCAGACCACTGTGTTACCCTC (mouse S1P2), 5′-GAACCCGGGCAACCACGCATGCGCAGG and 5′-GTCGAATTCTCACTTGCAGAGGACCCCG (mouse S1P3), 5′-GAACCCGGGAACATCAGTACCTGGTCCACGC and GCGGAATTCTAGGTGCTGCGGACGCTGG (mouse S1P4), 5′-GAACCCGGGCTGCTGCGGCCGG and 5′-CGCGAATTCAGTCTGTAGCAGTAGGCACC (mouse S1P5), 5′-GTAGGATCCGTGTCCTCCACCAGCATC and 5′-GGCCGAATTCTTAAGAAGAAGAATTGACGTTTC (rat S1P1), and 5′-GAACCCGGGCATCCACGCATGCGCAG and 5′-GCCGAATTCTCACTTGCAGAGGACCCCATTCTG (rat S1P3). The polymerase chain reaction products were inserted in frame after a FLAG tag using vector pCMV-Tag2 (Stratagene, La Jolla, CA). Stable lines were established by transfecting plasmids into CHO cells using lipofectamine reagent, selecting for neomycin resistance, and screening single cell cultures for increased [33P]S1P-specific binding. Membranes were prepared from positive clones and confirmed in [33P]S1P and [35S]GTPγS binding assays.

S1P Receptor Assays. Binding assays were conducted as previously described (Mandala et al., 2002). In brief, [33P]S1P was sonicated with fatty acid-free bovine serum albumin, added to test compounds diluted in dimethyl sulfoxide, and mixed with membranes in 200 μl in 96-well plates with assay concentrations of 0.1 nM [33P]S1P (22,000 dpm), 0.5% bovine serum albumin, 50 mM HEPES-Na (pH 7.5), 5 mM MgCl2, 1 mM CaCl2, and 0.3 to 0.7 μg of membrane protein. Binding was performed for 60 min at room temperature and terminated by collecting the membranes onto GF/B filter plates with a Packard Filtermate Universal Harvester. Filter bound radionuclide was measured on a PerkinElmer 1450 MicroBeta. Specific binding was calculated by subtracting radioactivity that remained in the presence of 1000-fold excess of unlabeled S1P.

To measure functional activation of the S1P receptors, [35S]GTPγS binding was measured. Membranes (1-4 μg of protein) were incubated in 96-well plates with test compounds diluted in dimethyl sulfoxide in 100 μl of buffer containing 20 mM HEPES (pH 7.4), 100 mM NaCl, 10 mM MgCl2, and 2 to 10 μM GDP, depending on the expressed receptor. The assay was initiated with the addition of 100 μl of [35S]GTPγS (1200 Ci/mmol; PerkinElmer Life and Analytical Sciences, Boston, MA) for an assay concentration of 125 pM. After 60 min of incubation at room temperature, membranes were harvested, onto GF/B filter plates and bound radionuclides were measured as described for ligand binding. S1P was subject to significant dephosphorylation in the [35S]GTPγS binding assay as measured with [33P]S1P or [3H]S1P. EC50 values are not reported for S1P. Degradation of S1P was less than 10% in the [33P]S1P binding assay, and [3H]-Compound A was not metabolized under either assay condition.

Assessment of Cardiovascular Function. Cardiovascular function was assessed in anesthetized and conscious rats and in conscious mice. Anesthetized rats were used to evaluate the dosedependent profile of cardiovascular responses to S1P receptor agonists of differing S1P receptor selectivity. Conscious rats were used to verify data from anesthetized animals and to allow a longer period of observation (4 h) that included a concurrent assessment of the induction of lymphopenia. The use of conscious mice allowed a comparison of compound effects in wild-type animals and mice with genetic deletion of the S1P3 receptor.

Anesthetized Rat Cardiovascular Assay. For the assessment of cardiovascular function in anesthetized rats, male Sprague-Dawley rats (300-350 g. b.wt.) with surgically implanted femoral artery and vein catheters were obtained from Charles River Laboratories (Raleigh, NC). Animals were anesthetized with Nembutal (55 mg/kg, i.p.), and a DTX pressure transducer (TNF-R; BD Biosciences, San Jose, CA) was attached to the arterial catheter and subsequently to a Gould ACQ-7700 data acquisition system using Po-Ne-Mah software (PNM-P3P) (Gould Instrument Systems, Valley View, OH). Heart rate was derived from the arterial pulse wave. Following an acclimation period, baseline values were determined (approximately 20-min duration); subsequently, compounds were administered intravenously (bolus injection of approximately 10 s). Cardiovascular data were recorded continuously and are reported as average values over 1-min intervals.

Conscious Rat Cardiovascular Assay. For the assessment of cardiovascular function in conscious rats, male Sprague-Dawley rats (300-350 g. b.wt.) with surgically implanted femoral artery and vein catheters were obtained from Charles River Laboratories. The catheters were connected to a tether (CIH95) and swivel (375/20; Instech Laboratories, Inc., Plymouth Meeting, PA), allowing the animal to move freely around the cage. Animals were allowed a minimum 2-day acclimation prior to further experimentation. On the day of study, a BD Biosciences DTX pressure transducer (TNF-R) was attached to the arterial catheter and subsequently to a Gould ACQ-7700 data acquisition system using Po-Ne-Mah software. Heart rate was derived from the arterial pulse wave. Heart rate and arterial pressure were measured for between 30 and 60 min to establish baseline values. Subsequently, compound or vehicle was administered as a continuous intravenous infusion of 25 μl/min for 4 h. Blood samples, for the evaluation of circulating leukocytes, were obtained from the arterial catheter 30 min prior to dosing and 1 and 4 h post initiation of the infusion. Cardiovascular data were recorded continuously and are reported as average values over 1-min intervals.

Mouse Cardiovascular Assay. For the assessment of cardiovascular function in conscious mice, the S1P3 receptor was genetically deleted (R. L. Proia, manuscript submitted for publication) and bred at Taconic Farms Inc. (Germantown, NY). Male (B6.129) S1P3-/- and S1P3+/+ mice (20-30 g b.wt.) were anesthetized with ketamine (80-100 mg/kg, i.p.) and xylazine (10 mg/kg, i.p.), and catheters were placed in a carotid artery (PE-50, with tip modified) and Jugular vein (PE-10). The catheters were tunneled subcutaneously to the nape and exteriorized. The catheters were connected to a tether (CIH62) and swivel (375/25P; Instech Laboratories, Inc.), allowing the animal to move freely around the cage. Following surgery, animals were allowed an overnight recovery period prior to further experimentation. On the day of study, a BD Biosciences DTX pressure transducer was attached to the arterial catheter and subsequently to a Gould ACQ-7700 data acquisition system using Po-Ne-Mah software. Heart rate was derived from the arterial pulse wave. Heart rate and arterial pressure were measured for between 30 and 60 min to establish baseline values. Subsequently, compound or vehicle was administered intravenously as a bolus of 10-s duration. Cardiovascular data were recorded continuously and are reported as average values over 10-s intervals.

Immunohistochemical Localization of S1P1 and S1P3 in Rat Heart. Peptides to the N terminus of mouse S1P3 (ATTHAQGHQPVLGNDTLREHYDYVGKLAGRLRDPPEGGTL) and mouse S1P1 (VSTSIPEVKALRSSVSDYGNYDIIVRHYNYTGKLNIGAEKDHGIK) and the C terminus of S1P1 (EGDNPETIMSSGNVNSSS) were synthesized (SynPep Corp., Dublin, CA), conjugated to KLH, and used to immunize rabbits (Covance Research Products, Denver, PA). Specific IgG fractions were affinity purified using the immunizing peptides. The resulting antisera were tested by Western blot across a panel of human, mouse, and rat S1P receptors. MS2031 to S1P3 was specific for the rodent S1P3 receptors. For the S1P1 antisera, MS2029 to the N terminus was specific for rodent S1P1, whereas the C-terminal antisera, MS1766, recognized human and rodent S1P1. Staining by Western and immunohistochemistry was blocked by incubation with the relevant but not the irrelevant peptide.

For histochemical studies, blocks of atrium or ventricle from rats or mice treated with a lethal dose of sodium pentobarbital were rapidly dissected out and immediately placed in cryomolds (catalog no. 4557; TissueTek, Torrance, CA) filled with O.C.T. Compound (TissueTek catalog no. 4583), frozen in liquid nitrogen, and stored at -80°C. Frozen sections were cut (5-μm thickness) on a Bright Model OTF cryotome (Hacker Instruments, Fairfield, NJ) and mounted on coated slides (catalog no. CFSACS; Instrumedics, Inc., Hackensack, NJ). To block nonspecific labeling, sections were treated with 5% donkey serum in PBS for 20 min, then with a clarified solution of 5% nonfat dry milk for 30 min, and finally with Fc blocker (Accurate Chemical, Westbury, NY) for 20 min. Sections were labeled for 1 h with affinity-purified primary antibodies or appropriate IgG controls (5 μg/ml): rabbit anti-mouse S1P1, rabbit anti-human S1P1, rabbit anti-mouse S1P3, and mab anti-rat PECAM (CD31 Pharmingen, catalog no. 555025; BD PharMingen, San Diego, CA). All nonimmune IgG controls were obtained from Jackson ImmunoResearch Laboratories Inc. (West Grove, PA). Slides were washed and incubated with affinity-purified F(ab′)2 donkey anti-rabbit or rat Cy2 (green fluorescence) or Cy3 (red fluorescence) conjugated secondary antibodies (5 μg/ml, 30 min) from Jackson ImmunoResearch Laboratories Inc. For double labeling studies, two primary antibodies raised in different species or corresponding species-specific fluorescent secondary antibodies were mixed together and incubated simultaneously on each slide. Nonimmune IgG controls also were run in this fashion. Specificity also was demonstrated by pre-incubating each primary antibody at staining concentrations with its relevant or irrelevant peptide at 5 μg/ml for 1 h and centrifugation for 1 h at 13,500g at 4°C (Beckman Microfuge 11; Beckman Coulter, Fullerton, CA). After staining, the slides were fixed for 30 min in 4% formaldehyde freshly generated from paraformaldehyde in phosphate buffer (pH 7.4; catalog no. 04042500; Fisher Scientific Co., Pittsburgh, PA). Coverslips were mounted on the slides with Vectashield plus DAPI nuclear stain (catalog no. H1200, Vector Laboratories, Burlingame, CA). Sections were photographed and analyzed with an Everest imaging system from Intelligent Imaging Innovations (Denver, CO) equipped with an Axioplan 2 microscope (Carl Zeiss, Göttingen, Germany). This system allows the viewer to visualize two different fluorochrome conjugated secondary antibodies individually or in combination on the same section in double labeling experiments.

Results

Lymphopenia, Toxicity, and in Vitro Activity of S1P Receptor Agonists. The phosphonate analog (Compound B) of the phosphate-ester metabolite of FTY720 (Compound A) was found previously to deplete peripheral blood lymphocytes with a 15-fold right shift in potency relative to FTY720 (Mandala et al., 2002). The shift in potency was consistent with its reduced affinity for S1P receptors. In an effort to identify more potent immunosuppressive compounds and explore structure activity relationships, additional analogs were synthesized (Fig. 1). Using a 3-h murine assay, Compound C and several analogs in the secondary amine phosphonate series were found to reduce circulating blood lymphocytes (Fig. 2). Compound D was 2-fold less active than Compound A and was the most potent phosphonate analog tested. However, efficacy could only be assessed within a narrow concentration range due to toxicity. Doses higher than 0.05 mg/kg of Compound D induced symptoms of ataxia and paralysis, and 0.25 mg/kg was lethal. Compounds C and E were 5- to 10-fold less active than D in reducing peripheral blood lymphocytes, and compound F had the weakest activity with an ED50 of 2.2 mg/kg. No toxicity was observed with Compounds E and F.

    Fig. 1.
  • Download figure
  • Open in new tab
  • Download powerpoint
Fig. 1.

Chemical structures of S1P and synthetic S1P receptor agonists.

    Fig. 2.
  • Download figure
  • Open in new tab
  • Download powerpoint
Fig. 2.

Dose response of S1P receptor agonists in peripheral blood lymphocyte depletion. Compounds were administered as an intravenous bolus to mice (n = 3), and total blood lymphocytes were determined 3 h later.

To investigate S1P receptor selectivity of the analogs, they were tested against human receptors expressed in CHO cells in competitive ligand binding assays using [33P]S1P as the ligand and functional assays of G protein coupling using [35S]GTPγS binding (Table 1). As previously determined for Compounds A and B, none of the phosphonates had significant activity against S1P2. All compounds were agonists on the other four S1P receptors, and maximal efficacy in [35S]GTPγS binding was similar to that observed with Compound A. Compound D was the most potent phosphonate on S1P1 with an IC50 of 0.9 nM that was only 2- to 3-fold less active than S1P or Compound A. Compound D was also the most active synthetic analog on S1P3, with an IC50 of 7.9 nM that was equivalent to Compound A but less potent relative to S1P. The 2-bromo and 5-methoxy substitutions to the phenyl ring found in Compounds E and F resulted in modest decreases in affinity for S1P1 and a substantial loss in activity on S1P3, which was further reduced by shortening the alkyl chain length in Compound F. All of the phosphonates had similar activity on S1P4, making this receptor unlikely to account for the differential effects of the analogs on lymphopenia or toxicity. Likewise, S1P5 did not appear to be a probable candidate for either in vivo effect given the equivalent potency of all three of the secondary amine compounds and the 20-fold reduced activity of Compound C on S1P5 relative to Compounds D to F.

View this table:
  • View inline
  • View popup
TABLE 1

Activity of compounds on human S1P receptors

Compounds were tested in [33P]S1P binding assays to determine IC50 values and [35S]GTPγS binding assays to determine EC50 values using membranes prepared from CHO cells expressing human S1P receptors. Values are the mean of two to six measurements performed in duplicate. S1P is subject to extensive metabolism under standard [35S]GTPγS binding assay conditions, and EC50 values are not shown.

Correlations between rodent in vivo pharmacological effects and human in vitro receptor assays can be misleading unless there is a high degree of conservation in the ligand binding pocket of the receptors. To address this issue, we cloned mouse S1P1,3,4,5 and rat S1P1,3 receptors and established stable CHO lines and assays that were comparable to those used to assess the human receptors. The overall homology between rodent and human S1P receptors ranged from 80% to 93%, with S1P1 being the most conserved protein. Ligand binding assays using the rodent receptors (Table 2) revealed that the natural ligand and the synthetic compounds maintained similar potency and the same rank order of activity, thus indicating that there were no significant differences between rodent and human structure activity relationships. As was deduced previously from the human receptors, the correlation between S1P1 receptor activation and the ED50 for lymphopenia was highly significant (p < 0.001) and much lower for the other receptors. All of the compounds had low or sub-nanomolar potency on S1P1, and the rank order of activity was Compound A > D > C > E > F.

View this table:
  • View inline
  • View popup
TABLE 2

Lymphopenic and toxic effects of compounds in mice compared with binding activity on rodent S1P receptors

ED50 values (±S.E.) are the dose (in milligrams per kilogram) that produces 50% of the maximum reduction in peripheral blood lymphocytes at 3 h. Toxicity is the maximum tolerated dose (milligrams per kilogram) as defined under Materials and Methods. Compounds were tested in vitro in [33P]S1P binding assays to determine IC50 values (nanomolar) using membranes prepared from CHO cells expressing mouse and rat S1P receptors.

Intravenous administration of some of the compounds evoked toxicity with symptoms that ranged from transient ruffling and paralysis to lethality. Compound D was the least tolerable compound tested and the most potent synthetic analog on mouse S1P3 with an IC50 of 1.8 nM. The other two compounds in the secondary amine series (E and F) had considerably reduced potency at mouse S1P3 with IC50 values of 0.6 and 6.6 μM, respectively, and did not induce any adverse symptoms in mice. Only mild, transient toxicity was observed with Compound C, which had intermediate activity on S1P3. Compound A induced transient signs of toxicity in mice but was not lethal up to 10 mg/kg, whereas S1P was highly toxic and was the most potent ligand for S1P3. To test whether toxicity was mediated via S1P3, as suggested by the correlation of in vitro receptor potency with the maximal tolerated dose (Table 2), the severely toxic compounds were studied in S1P3 null mice. In S1P3-/- mice, S1P and Compound D did not induce any toxic symptoms at 25 and 5 mg/kg, respectively, whereas they were rapidly lethal in their wild-type litter mate controls at doses of 5 and 0.25 mg/kg, respectively. S1P3-/- mice were fully susceptible to agonist-mediated lymphocyte depletion; peripheral blood lymphocyte counts from Compound D treated mice were 1.6 × 106/ml compared with 5.0 × 106/ml for vehicle-treated mice (p < 0.01).

Effects of S1P Receptor Agonists in Anesthetized Rats. Administration of either S1P (Fig. 3A) or the S1P1,3,4,5 agonist, Compound A (Fig. 3B), to anesthetized rats evoked an immediate decrease in heart rate, reaching a nadir within 1 to 2 min of compound administration and returning toward baseline values within 10 min. The effects on mean arterial pressure were more complex. Initially, a rapid hypotension was observed that reversed concomitantly with an increase in heart rate. In some instances, an overshoot to a transient hypertension was observed before returning to baseline. Subsequently, a gradually developing somewhat variable hypertension was seen that peaked approximately 10 min post-compound administration before resolving within 20 min. This late hypertension attained statistical significance in animals administered S1P but not in those administered Compound A.

    Fig. 3.
  • Download figure
  • Open in new tab
  • Download powerpoint
Fig. 3.

The effects of S1P (A) and Compound A (B) on mean arterial pressure (MAP) and heart rate (HR) were evaluated in barbiturate-anesthetized rats (three per group). HR and MAP were recorded continuously and are expressed as average values at 1-min intervals. Error bars have been omitted for the sake of clarity. Compounds were administered (arrow) as an intravenous bolus of approximately 10-s duration at 0.2 (A) or 0.05 (B) mg/kg. Significant differences from baseline control values are shown as: *, p < 0.05 for HR; and Embedded Image, p < 0.05 for MAP.

The effects of S1P receptor agonists with varying in vitro potency for activation of S1P1 and S1P3 receptors were evaluated for their ability to evoke bradycardia in the anesthetized rat. The extent of bradycardia, expressed as the peak decrease in heart rate as a percentage change from the average baseline value recorded for 20 min prior to compound administration, is shown in Fig. 4. The rank order of potency of S1P agonists for producing bradycardia in the anesthetized rat was Compound A ≥ D > E ∼ S1P >> Compound F. The reduced effects of Compounds E and F on heart rate are consistent with their reduced IC50 values against S1P3 in vitro.

    Fig. 4.
  • Download figure
  • Open in new tab
  • Download powerpoint
Fig. 4.

The effects of S1P receptor agonists on heart rate (HR) were evaluated in barbiturate-anesthetized rats. HR was determined for at least 15 min prior to and 30 min post-compound administration at the doses shown. Decrease in heart rate was calculated as the maximum change in heart rate during the 10-min period after compound administration in comparison with the average value for 5 min prior to compound administration. Each data point represents the mean, and vertical lines represent the S.E.M. for three to five animals per group.

Effects of S1P Receptor Agonists in Conscious Rats. Administration of Compound A by continuous intravenous infusion to conscious rats produced time- and dose-dependent lymphopenia, bradycardia, and hypertension. At a dose of 10 μg/kg/min, bradycardia (Fig. 5A) and hypertension (Fig. 5B) were evident within 15 to 30 min postinitiation of infusion, with slower onset of effects at lower doses of compound (data not shown). Similarly, upon cessation of infusion, cardiovascular parameters returned to baseline values within 15 to 30 min. The decrease in circulating leukocytes was also dose dependent (Fig. 6). The dose dependence for the pharmacological effects of Compound A in conscious rats (Fig. 6) indicates that maximal lymphopenia was obtained at an infusion dose of less than 0.1 μg/kg/min, whereas significant changes in heart rate and mean arterial pressure were not evident until doses of 1 μg/kg/min or greater were administered.

    Fig. 5.
  • Download figure
  • Open in new tab
  • Download powerpoint
Fig. 5.

The effects of Compound A on heart rate (A, HR) and mean arterial pressure (B, MAP) were evaluated in conscious unrestrained rats. Compound A or an equivalent volume of vehicle was infused intravenously for 4 h during the period as indicated. HR and MAP were recorded continuously and are expressed as average values at 1-min intervals. Each data point represents the mean, and vertical lines represent the S.E.M. for three to five animals per group.

    Fig. 6.
  • Download figure
  • Open in new tab
  • Download powerpoint
Fig. 6.

The effects of Compound A on heart rate (HR), MAP, and circulating lymphocytes were evaluated in conscious unrestrained rats. Compound A at the doses shown was infused intravenously for 4 h. Changes in HR and MAP were calculated as the average recorded value for the entire period of infusion as a percentage of the average value for the 20-min period prior to compound administration. Changes in lymphocytes are the number of cells measured in peripheral blood obtained at the conclusion of compound administration as a percentage of the number determined in a blood sample collected 30 min prior to compound administration. Each data point represents the mean and vertical lines the S.E.M. for three to five animals per group.

Effects of S1P Receptor Agonists in Conscious Mice. Toxicity of S1P and Compound D were abrogated in mice with a genetic deletion of the S1P3 receptor. In accordance, the cardiovascular effects of S1P receptor agonists were evaluated in S1P3-/- mice. Administration of either S1P or Compound A to conscious unrestrained mice evoked significant bradycardia compared with predose values in wild-type mice (Fig. 7). However, in S1P3-/- mice, administration of either Compound A or S1P did not produce any change in heart rate. Furthermore, as was observed in anesthetized and conscious rats, both compounds produced an increase in MAP in wild-type mice. In S1P3-/- mice, administration of Compound A evoked a small but significant decrease in MAP, whereas S1P administration was without effect on blood pressure. In wild-type or S1P3-/- mice that received an equivalent volume of vehicle, there were no meaningful changes in either heart rate or MAP. S1P3+/- heterozygote mice had the same response to Compound A as wild-type mice (data not shown).

    Fig. 7.
  • Download figure
  • Open in new tab
  • Download powerpoint
Fig. 7.

The effects of the S1P receptor agonists, Compound A (0.005 mg/kg, A and B) and S1P (0.1 mg/kg, C and D), on heart rate (HR, A and C) and MAP (B and D) were evaluated in conscious unrestrained wild-type or S1P3 receptor knock out mice (four to seven per group). HR and MAP were recorded continuously and are expressed as average values at 1-min intervals. Error bars have been omitted for the sake of clarity. Compounds were administered (arrow) as an intravenous bolus of approximately 10-s duration. Significant differences from baseline control values are shown as: *, p < 0.05 for wild type; and Embedded Image, p < 0.05 for S1P3 knockout mice.

Localization of S1P1 and S1P3 in Rodent Heart. As expected, S1P1 was heavily expressed by the vascular endothelial cells of capillaries (Fig. 8A) and larger blood vessels (Fig. 8F), but S1P1 expression was not detectable in cardiomyocytes of normal rat heart. In contrast, intense S1P3 labeling was observed along the cell surface membranes of rat ventricular and atrial cardiomyocytes, and moderate S1P3 expression was also seen within the myocyte cytoplasm (Fig. 8, B and E). S1P3 labeling was also heavily localized on the outer cell membranes of wild-type mouse ventricular myocytes (Fig. 8C1) but was not detectable in S1P3 knockout mice (Fig. 8C2), demonstrating the specificity of the S1P3 labeling pattern. In contrast, vascular endothelial cells were similarly labeled by the S1P1 antibody in wild-type and S1P3 knockout mice (data not shown). Furthermore, while S1P1 labeling was readily detected in the vascular endothelium of rat hearts as indicated by double labeling with a PECAM mAb (Fig. 8F). No S1P3 expression was observed in the vascular endothelium (Fig. 8, D and E). However, the subadjacent layer of rat vascular smooth muscle exhibited considerable S1P3-specific staining (Fig. 8D). These results were shown to be immunospecific for both S1P1 and S1P3 expression by the following criteria: staining was inhibited by pretreatment of primary antibody with relevant, but not by irrelevant peptide; substitution of nonimmune rabbit IgG for the primary antibody abolished the labeling; similar S1P1 staining patterns occurred using either C- or N-terminal S1P1 antibodies; immunoblotting experiments conducted on crude cellular extracts demonstrated that all S1P antibodies used for immunohistochemistry specifically labeled their respective proteins; and staining of S1P3 was absent in the S1P3-/- mouse hearts (Fig. 8C), and staining of S1P1 was absent in S1P1-/- mouse embryos (Allende et al., 2003).

    Fig. 8.
  • Download figure
  • Open in new tab
  • Download powerpoint
Fig. 8.

Localization of S1P1 and S1P3 expression in rodent heart by immunofluorescence microscopy. A, anti-S1P1 (red fluorescence) labels the capillary endothelial cells but not the myocytes of the rat heart ventricle. Bar for A to C and E = 30 μm. B, anti-S1P3 (red fluorescence) is concentrated on the outer cell membranes of the rat ventricular (B1) and atrial (B2) myocytes. C, S1P3 (red fluorescence) is heavily expressed on the cell membranes of myocytes from wild-type mice (C1) but not in hearts from S1P3 knockout mice (C2). D1, double labeling of a rat heart atrial blood vessel showing intense PECAM (green fluorescence) staining of the endothelium and S1P3 expression (red fluorescence) in the surrounding smooth muscle. D2, same section shown in D1 viewed without green fluorescence. No detectable S1P3 expression is present in the endothelium. Bar for D and F = 15 μm. E, expression of PECAM (green fluorescence) and S1P3 (red fluorescence) in the rat heart atrium. A small blood vessel exhibits intense endothelial PECAM labeling without colocalized S1P3, which was localized in the surrounding myocytes. F, double labeling of a rat ventricular blood vessel showing codistribution of S1P1 (red fluorescence) and PECAM (green fluorescence) staining in the endothelium. The surrounding myocytes do not exhibit S1P1 expression. All sections were counterstained with DAPI nuclear stain (blue fluorescence).

Discussion

We have investigated the cardiovascular and lymphopenic effects of differentially selective S1P receptor agonists. S1P3 activity correlated with toxicity and bradycardia, and this association was confirmed using mice genetically deleted for S1P3. In contrast, S1P1 activity correlated significantly with depletion of circulating lymphocytes. S1P has been known to have essential functions on endothelial cells in regulating migration, angiogenesis, adherens junctions, and vascular permeability (Lee et al., 1999; Garcia et al., 2001), and S1P1/edg1 is required for vascular maturation (Liu et al., 2000; Allende et al., 2003). The physiological role for S1P receptors in regulating immune cell function has emerged only recently with the discovery that FTY720, a compound in clinical trials for transplantation, is a prodrug and that its phosphorylated active metabolite is an agonist on four of the five S1P receptors (Brinkmann et al., 2002; Mandala et al., 2002).

Unlike other immunosuppressants, FTY720 depletes peripheral blood CD4+, CD8+, and B lymphocytes and sequesters them in secondary lymphoid organs (Chiba et al., 1998). Within the lymph node, antigen presentation, activation, and proliferation of T cells are normal, memory and humoral responses are intact, but effector cells are unable to egress to mount a local immune response (Pinschewer et al., 2000; Xie et al., 2003). The mechanism of PBL depletion by FTY720 was first attributed to accelerated homing (Chiba et al., 1998), and early reports suggested that S1P4 might be the target for FTY720 action given its expression in leukocytes and effects on actin cytoskeletal rearrangement (Brinkmann et al., 2001). However, S1P1 mRNA is also highly expressed in lymphocytes, and retroviral transduction of S1P1 into a Th1 line induced migratory responses to S1P (Dorsam et al., 2003). FTY720 was proposed to antagonize S1P-induced migration (Graeler and Goetzl, 2002), whereas we find that S1P acts similarly to FTY720 in redistributing blood lymphocytes to secondary lymphoid organs (Mandala et al., 2002).

Studies with analogs of FTY720 revealed that depletion of circulating lymphocytes correlated well with efficacy in promoting rat skin allograft survival (Kiuchi et al., 2000). Therefore, we used lymphopenia as a pharmacodynamic assay to analyze structure activity relationships of S1P receptor agonists. Ligand binding and G protein coupling assays with human, mouse, and rat receptors indicated that S1P and the five synthetic analogs described here have similar potencies and the same rank order of activity on the receptors from different species. Previous characterization of Compound B, the phosphonate analog of Compound A, revealed that the metabolically stabilized analog was able to induce lymphopenia despite a significant loss in potency on the S1P receptors (Mandala et al., 2002). A modest improvement in S1P1 potency and in vivo activity was achieved with Compound C, the deshydroxy analog of B. We discovered that the primary amine was not essential for receptor activity and identified Compound D as one of the most potent phosphonate analogs. Compound D induced lymphopenia with an ED50 only 2-fold reduced relative to Compound A. None of the synthetic analogs had significant activity on S1P2, but Compounds A to D were relatively nonselective on the other receptors. Selectivity against S1P3 was achieved in the secondary amine series (Compounds E and F) by substitutions to the phenyl ring and alkyl chain shortening, with no change on S1P5 activity and only modest effects on S1P1 and S1P4. The correlation between S1P1 receptor activity and lymphopenia is highly significant, whereas none of the other receptor activities are consistent with efficacy.

Intravenous administration of compounds evoked toxicity that ranged from lethality (S1P and Compound D), transient symptoms of ruffling and paralysis (Compound A and C), to no adverse symptoms (Compounds E and F). The correlation between S1P3 receptor activity of the phosphonates and toxicity was very high, and compounds did not produce any acute symptoms in the S1P3-/- mice, although they did induce lymphopenia. However, S1P and Compound A were less toxic than Compound D despite enhanced or equivalent S1P3 potency, which we attribute to the metabolic lability of the phosphate ester bond. Compound A is relatively stable in blood but rapidly reaches equilibrium with FTY720 in vivo (Mandala et al., 2002), suggesting that the high kinase activity in blood is balanced by phosphatases.

The underlying mechanism of toxicity may be the cardiovascular effects of S1P receptor agonists mediated through activation of S1P3 receptors. This conclusion is derived from three observations. The rank order of compound potency for bradycardia is more closely aligned with the potency for activation of S1P3 than the other S1P receptors. Second, in conscious rats, the 10-fold shift in potency of Compound A for inducing lymphopenia versus bradycardia and hypertension is consistent with affinity for S1P1 relative to S1P3. Finally, in conscious S1P3 receptor knockout mice, S1P and Compound A did not evoke bradycardia, whereas significant decreases in heart rate were observed in control wild-type mice.

In clinical trials with FTY720, a dose-associated bradycardia has been reported (Budde et al., 2002). Furthermore, a negative chronotropic effect of S1P receptor agonists was observed in isolated perfused guinea pig hearts (Liliom et al., 2001) and in rabbit sinoatrial node cells (Guo et al., 1999). In contrast, S1P increases sinoatrial rate in a canine preparation (Sugiyama et al., 2000b). The discrepancy between these observations is not clear but could be a species-dependent difference. S1P and sphingosine phosphorylcholine activate an IK.Ach that is a major contributor to vagally mediated cardiac slowing (Bunemann et al., 1995; Liliom et al., 2001). S1P-induced activation of IK.Ach was suggested to be mediated via the S1P3 receptor subtype based on inhibition by the putative S1P3 receptor antagonist suramin (Himmel et al., 2000). However, suramin was only S1P3 selective in oocyte transfectants with heterologous G proteins and required micromolar levels for inhibition (Ancellin and Hla, 1999), whereas IK.Ach channel activity was inhibited at nM concentrations of suramin (Himmel et al., 2000).

The effects of S1P receptor agonists on MAP are complex. Intravenous administration of either S1P or Compound A to anesthetized rats evoked an initial decline in blood pressure contemporaneous with a rapid decline in heart rate. We surmise that the initial rapid decline in MAP may be secondary to reduced heart rate and cardiac output from S1P3 activation. The decrease in MAP was followed by an equally rapid restoration of pressure and, in many cases, a slight overshoot that may be a baroreflex response. Published studies on the effects of S1P agonists in anesthetized rats also describe a rapid decrease in MAP of short duration in response to intravenous administration of S1P (Sugiyama et al., 2000a). Intravenous administration of FTY720 (1 mg/kg) produces an increase in MAP that normalized within 30 min, whereas a higher dose of FTY720 (5 mg/kg) produces an immediate decline in MAP that reversed within 10 min (Tawadrous et al., 2002). However, because these studies did not include information on changes in heart rate, it is difficult to provide a meaningful comparison with our own data.

Continuous intravenous infusion of S1P receptor agonists in conscious animals induced hypertension. The data obtained in S1P3 receptor knockout and wild-type mice are consistent with hypertension mediated via S1P3 receptors. Interestingly, Compound A, but not S1P, produced a modest hypotension in the S1P3 knockout mice. It is conceivable that the hypotensive response evoked with Compound A may not be mediated via S1P receptors. Alternatively, S1P receptor agonists may have opposing effects on MAP, a hypertensive response mediated via S1P3 receptors and a hypotensive response mediated via other S1P receptor subtype(s). Indeed, S1P has been reported to evoke vasoconstriction in isolated vascular preparations at concentrations >0.1 μM (Bischoff et al., 2000; Tosaka et al., 2001; Salomone et al., 2003), whereas vasorelaxation was observed at S1P concentrations <0.1 μM (Dantas et al., 2003). The contractile response was attributed to S1P3 activation (Salomone et al., 2003), whereas relaxation was attributed to S1P receptor-mediated activation of endothelial nitric oxide synthase and NO-dependent vasodilation (Dantas et al., 2003). Thus, the net effect of S1P on MAP will depend on the relative affinities for S1P receptors that mediate vasorelaxation versus those that mediate vasoconstriction.

Immunohistochemical studies on rat and mouse atrial and ventricular heart tissue revealed an intense expression of S1P3 on myocytes and vascular smooth muscle cells that was absent in the S1P3-/- mice. This report is the first description of S1P3 immunolocalization in heart tissue, although the same distribution pattern for S1P3 mRNA was observed in human heart tissue (Mazurais et al., 2002). In contrast to S1P3, which was not detectable on endothelium, anti-S1P1 labeled endothelial cells almost exclusively. Intense anti-S1P1 staining of capillaries and endothelium of large blood vessels was observed with significant PECAM codistribution. In contrast to other reports (Nakajima et al., 2000; Robert et al., 2001), we did not observe any detectable S1P1 expression on cardiomyocytes. Species or antibody specificity may explain the differing results.

In conclusion, we describe novel pharmacological tools that have helped distinguish the subtype-specific roles of S1P receptors in regulating lymphocyte recirculation and cardiovascular function. Further mechanistic insight will be required to confirm the hypothesis that S1P1 is the molecular target for the immunosuppressive effects of FTY720 and to characterize the pathway between S1P1 activation and lymphocyte sequestration. Bradycardia and hypertension were clearly associated with S1P3 activation and its expression patterns in cardiac tissue; these reagents should be useful in further dissecting the complexities of S1P mediated regulation of blood pressure.

Footnotes

  • ↵1 Present address: Array BioPharma, Boulder, CO.

  • ↵2 Present address: The Scripps Research Institute, La Jolla, CA.

  • DOI: 10.1124/jpet.103.062828.

  • ABBREVIATIONS: S1P, sphingosine 1-phosphate; IK.Ach, inwardly rectifying K+ currents; CHO, Chinese hamster ovary; MAP, mean arterial pressure; DAPI, 4,6-diamidino-2-phenylindole; [35S]GTPγS, guanosine 5′-O-(3-[35S]thio)triphosphate; FTY720, 2-amino-2-(2-[4-octylphenyl] ethyl)-1,3-propanediol; PECAM, platelet-endothelial cell adhesion molecule.

    • Received November 11, 2003.
    • Accepted January 26, 2004.
  • The American Society for Pharmacology and Experimental Therapeutics

References

  1. ↵
    Allende ML, Yamashita T, and Proia RL (2003) G-protein-coupled receptor S1P1 acts within endothelial cells to regulate vascular maturation. Blood 102: 3665-3667.
    OpenUrlAbstract/FREE Full Text
  2. ↵
    Ancellin N and Hla T (1999) Differential pharmacological properties and signal transduction of the sphingosine 1-phosphate receptors EDG-1, EDG-3 and EDG-5. J Biol Chem 274: 18997-19002.
    OpenUrlAbstract/FREE Full Text
  3. ↵
    Bischoff A, Czyborra P, Fetscher C, zu Heringdorf DM, Jakobs KH, and Michel MC (2000) Sphingosine-1-phosphate and sphingosylphosphorylcholine constrict renal and mesenteric microvessels in vitro. Br J Pharmacol 130: 1871-1877.
    OpenUrlCrossRefPubMed
  4. ↵
    Brinkmann V, Davis MD, Heise CE, Albert R, Cottens S, Hof R, Bruns C, Prieschl E, Baumruker T, Hiestand P, et al. (2002) The immune modulator, FTY720, targets sphingosine 1-phosphate receptors. J Biol Chem 277: 21453-21457.
    OpenUrlAbstract/FREE Full Text
  5. ↵
    Brinkmann V, Pinschewer DD, Feng L, and Chen S (2001) FTY720: altered lymphocyte traffic results in allograft protection. Transplantation 72: 764-769.
    OpenUrlCrossRefPubMed
  6. ↵
    Budde K, Schmouder RL, Brunkhorst R, Nashan B, Luecker PW, Mayer T, Choudhury S, Skerjanec A, Kraus G, and Neumayer HH (2002) First human trial of FTY720, a novel immunomodulator, in stable renal transplant patients. J Am Soc Nephrol 13: 1073-1083.
    OpenUrlAbstract/FREE Full Text
  7. ↵
    Bunemann M, Brandts B, zu Heringdorf DM, van Koppen CJ, Jakobs KH, and Pott L (1995) Activation of muscarinic K+ current in guinea-pig atrial myocytes by sphingosine-1-phosphate. J Physiol 489: 701-707.
    OpenUrlPubMed
  8. ↵
    Chiba K, Yanagawa Y, Masubuchi Y, Kataoka H, Kawaguchi T, Ohtsuki M, and Hoshino Y (1998) FTY720, a novel immunosuppressant, induces sequestration of circulating mature lymphocytes by acceleration of lymphocyte homing in rats: I. FTY720 selectively decreases the number of circulating mature lymphocytes by acceleration of lymphocyte homing. J Immunol 160: 5037-5044.
    OpenUrlAbstract/FREE Full Text
  9. ↵
    Chun J, Goetzl EJ, Hla T, Igarashi Y, Lynch KR, Moolenaar W, Pyne S, and Tigyi G (2002) International union of pharmacology: XXXIV. Lysophospholipid receptor nomenclature. Pharmacol Rev 54: 265-269.
    OpenUrlAbstract/FREE Full Text
  10. ↵
    Dantas APV, Igarashi J, and Michel T (2003) Sphingosine 1-phosphate and control of vascular tone. Am J Physiol Heart Circ Physiol 284: H2045-2052.
    OpenUrlAbstract/FREE Full Text
  11. ↵
    Dorsam G, Graeler MH, Seroogy C, Kong Y, Voice JK, and Goetzl EJ (2003) Transduction of multiple effects of sphingosine 1-phosphate (S1P) on T cell functions by the S1P1 G protein-coupled receptor. J Immunol 171: 3500-3507.
    OpenUrlAbstract/FREE Full Text
  12. ↵
    Dumont FJ (2000) FTY720 Novartis/Yoshitomi. Curr Opin Investig Drugs 2: 314-331.
    OpenUrl
  13. ↵
    Durand P, Peralba P, Sierra F, and Renaut P (2000) A new efficient synthesis of the immunosuppressive agent FTY720. Synth Stuttg 2000: 505-506.
    OpenUrlCrossRef
  14. ↵
    Garcia JGN, Liu F, Verin AD, Birukova A, Dechert MA, Gerthoffer WT, Bamberg JR, and English D (2001) Sphingosine 1-phosphate promotes endothelial cell barrier integrity by Edg-dependent cytoskeletal rearrangement. J Clin Invest 108: 689-701.
    OpenUrlCrossRefPubMed
  15. ↵
    Graeler M and Goetzl EJ (2002) Activation-regulated expression and chemotactic function of sphingosine 1-phosphate receptors in mouse splenic T cells. FASEB J 16: 1874-1878.
    OpenUrlAbstract/FREE Full Text
  16. ↵
    Graeler MH, Bernhardt G, and Lipp M (1999) A lympoid tissue-specific receptor, EDG6, with potential immune modulatory functions mediated by extracellular lysophospholipids. Curr Top Microbiol Immunol 246: 131-136.
    OpenUrlPubMed
  17. ↵
    Guo J, MacDonnell KL, and Giles WR (1999) Effects of sphingosine 1-phosphate on pacemaker activity in rabbit sino-atrial node cells. Pflugers Arch Eur J Physiol 438: 642-648.
    OpenUrlCrossRefPubMed
  18. ↵
    Himmel HM, zu Heringdorf DM, Graf E, Dobrev D, Kortner A, Schueler S, Jakobs KH, and Ravens U (2000) Evidence for Edg-3 receptor-mediated activation of IK. ACh by sphingosine-1-phosphate in human atrial cardiomyocytes. Mol Pharmacol 58: 449-454.
    OpenUrlAbstract/FREE Full Text
  19. ↵
    Hla T, Lee M-J, Ancellin N, Paik JH, and Kluk MJ (2001) Lysophospholipids: receptor revelations. Science 294: 1875-1878.
    OpenUrlAbstract/FREE Full Text
  20. ↵
    Im DS, Heise CE, Ancellin N, O'Dowd BF, Shei GJ, Heavens RP, Rigby MR, Hla T, Mandala S, McAllister G, et al. (2000) Characterization of a novel sphingosine 1-phosphate receptor, Edg-8. J Biol Chem 275: 14281-14286.
    OpenUrlAbstract/FREE Full Text
  21. ↵
    Ishii I, Friedman B, Ye X, Kawamura S, McGiffert C, Contos JJA, Kingsbury MA, Zhang G, Brown JH, and Chun J (2001) Selective loss of sphingosine 1-phosphate signaling with no obvious phenotypic abnormality in mice lacking its G protein-coupled receptor, LPB3/EDG-3. J Biol Chem 276: 33697-33704.
    OpenUrlAbstract/FREE Full Text
  22. ↵
    Kiuchi M, Adachi K, Kohara T, Minoguchi M, Hanano T, Aoki Y, Mishina T, Arita M, Nakao N, Ohtsuki M, et al. (2000) Synthesis and immunosuppressive activity of 2-substituted-2-aminopropane-1,3-diols and 2-aminoethanols. J Med Chem 43: 2946-2961.
    OpenUrlCrossRefPubMed
  23. ↵
    Lee M-J, Thangada S, Claffey KP, Ancellin N, Liu CH, Kluk M, Volpi M, Sha'afi RI, and Hla T (1999) Vascular endothelial cell adherens junction assembly and morphogenesis induced by sphingosine-1-phosphate. Cell 99: 301-312.
    OpenUrlCrossRefPubMed
  24. ↵
    Liliom K, Sun G, Bunemann M, Virag T, Nusser N, Baker DL, Wang D, Fabian MJ, Brandts B, Bender K, et al. (2001) Sphingosylphosphocholine is a naturally occurring lipid mediator in blood plasma: a possible role in regulating cardiac function via sphingolipid receptors. Biochem J 355: 189-197.
    OpenUrlCrossRefPubMed
  25. ↵
    Liu Y, Wada R, Yamashita T, Mi Y, Deng CX, Hobson JP, Rosenfeldt HM, Nava VE, Chae SS, Lee MJ, et al. (2000) Edg-1, the G protein-coupled receptor for sphingosine-1-phosphate, is essential for vascular maturation. J Clin Invest 106: 951-961.
    OpenUrlCrossRefPubMed
  26. ↵
    Mandala S, Hajdu R, Bergstrom J, Quackenbush E, Xie J, Milligan J, Thornton R, Shei G-J, Card D, Keohane C, et al. (2002) Alteration of lymphocyte trafficking by sphingosine-1-phosphate receptor agonists. Science 296: 346-349.
    OpenUrlAbstract/FREE Full Text
  27. ↵
    Mazurais D, Robert P, Gout B, Berrebi-Bertrand I, Laville MP, and Calmels T (2002) Cell type-specific localization of human cardiac S1P receptors. J Histochem Cytochem 50: 661-669.
    OpenUrlAbstract/FREE Full Text
  28. ↵
    Nakajima N, Cavalli AL, Biral D, Glembotski CC, McDonough PM, Ho PD, Betto R, Sandona D, Palade PT, Dettbarn CA, et al. (2000) Expression and characterization of Edg-1 receptors in rat cardiomyocytes: calcium deregulation in response to sphingosine 1-phosphate. Eur J Biochem 267: 5679-5686.
    OpenUrlPubMed
  29. ↵
    Niedernberg A, Scherer CR, Busch AE, and Kostenis E (2002) Comparative analysis of human and rat S1P5 (edg8): differential expression profiles and sensitivities to antagonists. Biochem Pharmacol 64: 1243-1250.
    OpenUrlCrossRefPubMed
  30. ↵
    Ohmori T, Yatomi Y, Osada M, Kazama F, Takafuta T, Ikeda H, and Ozaki Y (2003) Sphingosine 1-phosphate induces contraction of coronary artery smooth muscle cells via S1P2. Cardiovasc Res 58: 170-177.
    OpenUrlAbstract/FREE Full Text
  31. ↵
    Okamoto H, Takuwa N, Yokomizo T, Sugimoto N, Sakurada S, Shigematsu H, and Takuwa Y (2000) Inhibitory regulation of Rac activation, membrane ruffling and cell migration by the G protein-coupled sphingosine-1-phosphate receptor EDG5 but not EDG1 or EDG3. Mol Cell Biol 20: 9247-9261.
    OpenUrlAbstract/FREE Full Text
  32. ↵
    Pinschewer DD, Ochsenbein AF, Odermatt B, Brinkmann V, Hengartner H, and Zinkernagel RM (2000) FTY720 immunosuppression impairs effector T-cell peripheral homing without affecting induction, expansion and memory. J Immunol 164: 5761-5770.
    OpenUrlAbstract/FREE Full Text
  33. ↵
    Pyne S and Pyne NJ (2000) Sphingosine 1-phosphate signalling in mammalian cells. Biochem J 349: 385-402.
    OpenUrlCrossRefPubMed
  34. ↵
    Robert P, Tsui P, Laville MP, Livi GP, Sarau HM, Bril A, and Berrebi-Bertrand I (2001) Edg1 receptor stimulation leads to cardiac hypertrophy in rat neonatal myocytes. J Mol Cell Cardiol 33: 1589-1606.
    OpenUrlCrossRefPubMed
  35. ↵
    Salomone S, Yoshimura S-I, Reuter U, Foley M, Thomas SS, Moskowitz MA, and Waeber C (2003) S1P3 receptors mediate the potent constriction of cerebral arteries by sphingosine-1-phosphate. Eur J Pharmacol 469: 125-134.
    OpenUrlCrossRefPubMed
  36. ↵
    Sugiyama A, Aye NN, Yatomi Y, Ozaki Y, and Hashimoto K (2000a) Effects of sphingosine 1-phosphate, a naturally occurring biologically active lysophospholipid, on the rat cardiovascular system. Jpn J Pharmacol 82: 338-342.
    OpenUrlCrossRefPubMed
  37. ↵
    Sugiyama A, Yatomi Y, Ozaki Y, and Hashimoto K (2000b) Sphingosine 1-phosphate induces sinus tachycardia and coronary vasoconstriction in the canine heart. Cardiovasc Res 46: 119-125.
    OpenUrlAbstract/FREE Full Text
  38. ↵
    Tawadrous MN, Mabuchi A, Zimmermann A, and Wheatley AM (2002) Effects of immunosuppressant FTY720 on renal and hepatic hemodynamics in the rat. Transplantation 74: 602-610.
    OpenUrlCrossRefPubMed
  39. ↵
    Tosaka M, Okajima F, Hashiba Y, Saito N, Nagano T, Watanabe T, Kimura T, and Sasaki T (2001) Sphingosine 1-phosphate contracts canine basilar arteries in vitro and in vivo: possible role in pathogenesis of cerebral vasospasm. Stroke 32: 2913-2919.
    OpenUrlAbstract/FREE Full Text
  40. ↵
    Xie JH, Nomura N, Koprak SL, Quackenbush E, Forrest M, and Rosen H (2003) Sphingosine-1-phosphate receptor agonism impairs the efficiency of the local immune response by altering trafficking of naive and antigen-activated CD4+ T cells. J Immunol 170: 3662-3670.
    OpenUrlAbstract/FREE Full Text
View Abstract
PreviousNext
Back to top

In this issue

Journal of Pharmacology and Experimental Therapeutics: 309 (2)
Journal of Pharmacology and Experimental Therapeutics
Vol. 309, Issue 2
1 May 2004
  • Table of Contents
  • About the Cover
  • Index by author
Download PDF
Article Alerts
Sign In to Email Alerts with your Email Address
Email Article

Thank you for sharing this Journal of Pharmacology and Experimental Therapeutics article.

NOTE: We request your email address only to inform the recipient that it was you who recommended this article, and that it is not junk mail. We do not retain these email addresses.

Enter multiple addresses on separate lines or separate them with commas.
Immune Cell Regulation and Cardiovascular Effects of Sphingosine 1-Phosphate Receptor Agonists in Rodents Are Mediated via Distinct Receptor Subtypes
(Your Name) has forwarded a page to you from Journal of Pharmacology and Experimental Therapeutics
(Your Name) thought you would be interested in this article in Journal of Pharmacology and Experimental Therapeutics.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.
Citation Tools
Research ArticleCARDIOVASCULAR

Immune Cell Regulation and Cardiovascular Effects of Sphingosine 1-Phosphate Receptor Agonists in Rodents Are Mediated via Distinct Receptor Subtypes

M. Forrest, S.-Y. Sun, R. Hajdu, J. Bergstrom, D. Card, G. Doherty, J. Hale, C. Keohane, C. Meyers, J. Milligan, S. Mills, N. Nomura, H. Rosen, M. Rosenbach, G.-J. Shei, I. I. Singer, M. Tian, S. West, V. White, J. Xie, R. L. Proia and S. Mandala
Journal of Pharmacology and Experimental Therapeutics May 1, 2004, 309 (2) 758-768; DOI: https://doi.org/10.1124/jpet.103.062828

Citation Manager Formats

  • BibTeX
  • Bookends
  • EasyBib
  • EndNote (tagged)
  • EndNote 8 (xml)
  • Medlars
  • Mendeley
  • Papers
  • RefWorks Tagged
  • Ref Manager
  • RIS
  • Zotero
Share
Research ArticleCARDIOVASCULAR

Immune Cell Regulation and Cardiovascular Effects of Sphingosine 1-Phosphate Receptor Agonists in Rodents Are Mediated via Distinct Receptor Subtypes

M. Forrest, S.-Y. Sun, R. Hajdu, J. Bergstrom, D. Card, G. Doherty, J. Hale, C. Keohane, C. Meyers, J. Milligan, S. Mills, N. Nomura, H. Rosen, M. Rosenbach, G.-J. Shei, I. I. Singer, M. Tian, S. West, V. White, J. Xie, R. L. Proia and S. Mandala
Journal of Pharmacology and Experimental Therapeutics May 1, 2004, 309 (2) 758-768; DOI: https://doi.org/10.1124/jpet.103.062828
del.icio.us logo Digg logo Reddit logo Twitter logo CiteULike logo Facebook logo Google logo Mendeley logo
  • Tweet Widget
  • Facebook Like
  • Google Plus One

Jump to section

  • Article
    • Abstract
    • Materials and Methods
    • Results
    • Discussion
    • Footnotes
    • References
  • Figures & Data
  • Info & Metrics
  • eLetters
  • PDF

Related Articles

Cited By...

More in this TOC Section

  • Therapeutic Potential of Pharmacological DDAH
  • Effect of Acetate and on HR, BP, and Cardiac Contractility
  • Amphetaminelike Effects of α-Ethylphenethylamine Analogs
Show more Cardiovascular

Similar Articles

  • Home
  • Alerts
Facebook   Twitter   LinkedIn   RSS

Navigate

  • Current Issue
  • Fast Forward by date
  • Fast Forward by section
  • Latest Articles
  • Archive
  • Search for Articles
  • Feedback
  • ASPET

More Information

  • About JPET
  • Editorial Board
  • Instructions to Authors
  • Submit a Manuscript
  • Customized Alerts
  • RSS Feeds
  • Subscriptions
  • Permissions
  • Terms & Conditions of Use

ASPET's Other Journals

  • Drug Metabolism and Disposition
  • Molecular Pharmacology
  • Pharmacological Reviews
  • Pharmacology Research & Perspectives
ISSN 1521-0103 (Online)

Copyright © 2021 by the American Society for Pharmacology and Experimental Therapeutics