Human health implications of environmental contaminants in Arctic Canada: a review
…, P Usher, B Wheatley, H Kuhnlein, S Neve… - Science of the Total …, 1999 - Elsevier
This paper assesses the impact on human health of exposure to current levels of environmental
contaminants in the Canadian Arctic, and identifies the data gaps that need to be filled …
contaminants in the Canadian Arctic, and identifies the data gaps that need to be filled …
Plectasin, a fungal defensin, targets the bacterial cell wall precursor Lipid II
…, AK Nielsen, PH Mygind, DS Raventós, S Neve… - Science, 2010 - science.org
Host defense peptides such as defensins are components of innate immunity and have retained
antibiotic activity throughout evolution. Their activity is thought to be due to amphipathic …
antibiotic activity throughout evolution. Their activity is thought to be due to amphipathic …
A novel approach to the antimicrobial activity of maggot debridement therapy
…, KM Schnorr, T Kruse, S Neve… - Journal of …, 2010 - academic.oup.com
… We thank Dorotea Raventos (Novozymes A/S) for invaluable assistance with an … /S) for
expert assistance with quantification and MS work, and Hans-Henrik Kristensen (Novozymes A/S) …
expert assistance with quantification and MS work, and Hans-Henrik Kristensen (Novozymes A/S) …
[HTML][HTML] An amphipathic peptide with antibiotic activity against multidrug-resistant Gram-negative bacteria
AG Elliott, JX Huang, S Neve, J Zuegg… - Nature …, 2020 - nature.com
Peptide antibiotics are an abundant and synthetically tractable source of molecular diversity,
but they are often cationic and can be cytotoxic, nephrotoxic and/or ototoxic, which has …
but they are often cationic and can be cytotoxic, nephrotoxic and/or ototoxic, which has …
[HTML][HTML] Eurocin, a new fungal defensin: structure, lipid binding, and its mode of action
…, BS Vad, DH Sandvang, LA Nielsen, S Neve… - Journal of Biological …, 2012 - ASBMB
Antimicrobial peptides are a new class of antibiotics that are promising for pharmaceutical
applications because they have retained efficacy throughout evolution. One class of …
applications because they have retained efficacy throughout evolution. One class of …
Nuclear receptor corepressor-dependent repression of peroxisome-proliferator-activated receptor δ-mediated transactivation
AM Krogsdam, CAF Nielsen, S Neve, D Holst… - Biochemical …, 2002 - portlandpress.com
… The PPARδ–RXRα heterodimer bound to an acyl-CoA oxidase (ACO)-type peroxisomeproliferator
response element recruited a glutathione Stransferase–NCoR fusion protein in a …
response element recruited a glutathione Stransferase–NCoR fusion protein in a …
Glucagon-like peptide 1 receptor agonist ZP10A increases insulin mRNA expression and prevents diabetic progression in db/db mice
C Thorkildsen, S Neve, BD Larsen, E Meier… - … of Pharmacology and …, 2003 - ASPET
We characterized the novel, rationally designed peptide glucagon-like peptide 1 (GLP-1)
receptor agonist H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH 2 (…
receptor agonist H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH 2 (…
Cloning and characterization of human very-long-chain acyl-CoA dehydrogenase cDNA, chromosomal assignment of the gene and identification in four patients of …
…, MA Nada, A Byskov, TA Kruse, S Neve… - Human molecular …, 1996 - academic.oup.com
Very-long-chain acyl-CoA dehydrogenase (VLCAD) is one of four straight-chain acyl-CoA
dehydrogenase (ACD) enzymes, which are all nuclear encoded mitochondrial flavoproteins …
dehydrogenase (ACD) enzymes, which are all nuclear encoded mitochondrial flavoproteins …
[HTML][HTML] Ethylmalonic aciduria is associated with an amino acid variant of short chain acyl-coenzyme A dehydrogenase
…, S Neve, TG Jensen, L Bolund, S Kølvraa - Pediatric …, 1996 - nature.com
Ethylmalonic aciduria is a common biochemical finding in patients with inborn errors of short
chain fatty acid β-oxidation. The urinary excretion of ethylmalonic acid (EMA) may stem from …
chain fatty acid β-oxidation. The urinary excretion of ethylmalonic acid (EMA) may stem from …
An antimicrobial peptide from endophytic Fusarium tricinctum of Rhododendron tomentosum Harmaja
Endophytic microbes have attracted considerable attention as a completely new source of
pharmaceuticals in recent years. An endophytic Fusarium tricinctum was isolated from …
pharmaceuticals in recent years. An endophytic Fusarium tricinctum was isolated from …