JPET Assistant Professor of Medicine (Clinician-Educator)

Home Help [Feedback] [For Subscribers] [Archive] [Search] [Contents]
 QUICK SEARCH:   [advanced]


     


Journal of Pharmacology And Experimental Therapeutics Fast Forward
First published on January 3, 2007; DOI: 10.1124/jpet.106.114561


0022-3565/07/3203-1144-1152$20.00
JPET 320:1144-1152, 2007
This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow All Versions of this Article:
jpet.106.114561v1
320/3/1144    most recent
Right arrow Submit a response
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Citing Articles
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Du, P.
Right arrow Articles by Geoghegan, K. F.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Du, P.
Right arrow Articles by Geoghegan, K. F.

NEUROPHARMACOLOGY

Dominance of Amyloid Precursor Protein Sequence over Host Cell Secretases in Determining beta-Amyloid Profiles Studies of Interspecies Variation and Drug Action by Internally Standardized Immunoprecipitation/Mass Spectrometry

Ping Du, Kathleen M. Wood, Michele H. Rosner, David Cunningham, Barbara Tate, and Kieran F. Geoghegan

Pfizer Global Research and Development, Groton, Connecticut

Received October 2, 2006; accepted December 27, 2006.


    Abstract
 Top
 Abstract
 Materials and Methods
 Results
 Discussion
 References
 
beta-Amyloid peptides, tentatively regarded as the principal neurotoxins responsible for Alzheimer's Disease, make up a set of products that varies significantly among different biological systems. The full implications of this complexity and its variations have yet to be defined. In this work, Abeta peptide populations were extracted from animal brain tissue or cell-conditioned media, immunoprecipitated with specific antibodies, and analyzed by matrix-assisted laser desorption time-of-flight mass spectrometry. 15N-Substituted Abeta internal standards were added to gauge variations in the profile of captured peptides. Results from a range of species, including guinea pig, dog, rabbit, and wild-type and transgenic mice, showed that the Abeta peptide population in each system was mainly determined by the species of origin of the amyloid precursor protein (APP) and not by the host tissue or cell line. The same method was used to gauge the effect on the Abeta peptide profile of an inhibitor of {gamma}-secretase, one of the two proteinases that excises Abeta peptides from the precursor protein with different effects on specific peptides. Overall, the results demonstrate that the species of origin of the APP substrate dictates the outcome of APP processing to a greater extent than the origin of the processing enzymes, an important consideration in rationalizing the properties of different model systems.


Abeta peptides are tentatively regarded as the principal neurotoxins responsible for AD (Watson et al., 2005Go) and are formed by sequential proteolytic events near the C terminus of the 770-residue APP. They are also the main components of amyloid plaques that are the classical biomarker of AD in post mortem brain. In the first step of pathological processing, the membrane-bound aspartic proteinase BACE cleaves APP after Met-671 to generate a C-terminal fragment called APP-C-terminal fragment beta.Abeta species are liberated from this fragment by the intramembrane proteinase {gamma}-secretase. Both secretases are seen as important drug targets, because the amyloid hypothesis of AD implies that blocking the production of Abeta peptides will retard the disease (Gandy, 2005Go). The alternative {alpha}-secretory pathway does not lead to Abeta peptide production.

BACE is an atypical aspartic proteinase (Haniu et al., 2000Go), but it clearly belongs to that enzyme family and can be crystallized (Hong et al., 2000Go). {gamma}-Secretase is a much more enigmatic target. It too is an aspartic-dependent proteinase, but of a specialized type adapted for regulated intramembrane proteolysis (Landman and Kim, 2004Go). Its proteolytic activity resides in a complex that includes PS and several other proteins (Edbauer et al., 2004Go; Chyung et al., 2005Go). {gamma}-Secretase cleaves APP at various sites to produce Abeta peptides of different lengths. Cleavage at the "{gamma}-site" produces Abeta1–40 and Abeta1–42, the products that are widely attributed to play a major role in AD. These peptides oligomerize, aggregate, and ultimately accumulate in plaques (Citron et al., 1996Go). {gamma}-Site cleavage may be preceded by action of {gamma}-secretase at the "{epsilon} site" located after Leu-720 of APP, which releases a 50-residue peptide known as AICD (amyloid intracellular domain) (Gao and Pimplikar, 2001Go). More recently, formation of a 46-residue fragment of APP has also been attributed to {gamma}-secretase activity and termed the {zeta} cleavage (Zhao et al., 2004Go).

Analysis of AD brain tissue and brain tissue from transgenic mice expressing human APP has detected a variety of different Abeta peptides in extracellular amyloid deposits. In addition to Abeta1–40 and Abeta1–42, N-terminally and C-terminally truncated peptides and C-terminally elongated peptides have been reported. Abeta peptides with an N-terminal Glu-3 or Glu-11 (Naslund et al., 1994Go), as well as peptides with pyroglutamyl N termini at positions 3 and 11 (Miravalle et al., 2005Go; Rufenacht et al., 2005Go), have been detected in amyloid plaques from human brain. Plaques from transgenic mice expressing both human APP and PS, as well as plaques from human AD brains, have been reported to contain Abeta peptides 1 to 16 and 17 to 28 (Rufenacht et al., 2005Go). C-terminally truncated peptides, including Abeta1–37, Abeta1–38, and Abeta1–39, have also been found in plaques from two different transgenic mouse lines (Lewis et al., 2004Go) and in cerebrospinal fluid of AD patients (Lewczuk et al., 2003Go). The biological function and disease relevance of the various Abeta peptides is not understood, and the full complexity of processing, both of the precursor protein and Abeta fragments, has yet to be resolved.

The production of Abeta1–42 is favored by mutations of APP or PS linked to early-onset or familial forms of AD (Clark et al., 1995Go). Because Abeta1–42 forms fibrils more readily than most other Abeta peptides and is the major component of congophilic plaques in AD brain, the production of Abeta1–42 is believed to favor progression of the disease. Thus, both the substrate sequence and mutations within the enzyme may influence the final profile of products from {gamma}-secretase-catalyzed cleavage of APP, and subtle differences in these profiles may be highly significant.

These considerations led us to use IP followed by MALDI-TOF MS to observe Abeta profiles from the brains of several preclinical species and from transgenic mice expressing mutant forms of human APP. Recently, several groups have reported the incorporation of internal standards into Abeta samples subjected to MS, allowing quantitation of specific Abeta peptides (Miravalle et al., 2005Go; Rufenacht et al., 2005Go). In this work, we incorporated multiple internal standards to monitor changes in several specific Abeta peptides. The results indicated that the sequence of APP is the major factor governing which Abeta peptides are produced by proteolytic processing and that the species identity of the host cell or tissue is a less important factor.


    Materials and Methods
 Top
 Abstract
 Materials and Methods
 Results
 Discussion
 References
 
Immobilization of Capture Antibodies. Biotinylated monoclonal antibodies 6E10 and 4G8 (both from Signet Laboratories, Dedham, MA) were immobilized by incubation with ImmunoPure Immobilized Streptavidin (Pierce Chemical, Rockford, IL) at a ratio of 0.06 mg of antibody for each 0.06 ml of bead slurry, after which unoccupied biotin-binding sites on the beads were blocked with biotin. The choice of antibody depended on the sample. With brain extracts of wild-type mouse and rat, 0.06 mg of 4G8 antibody was used for each sample. For brain extracts of dog, rabbit, Tg2576 transgenic mouse, or APP Dutch transgenic mouse or with conditioned medium of human H4 cells, 0.03 mg each of both 6E10 and 4G8 was used for capture. For brain extracts of guinea pig, either 0.06 mg of 4G8 alone or 0.03 mg each of 6E10 and 4G8 was used. Before use, the antibody beads were washed twice in 5 volumes of Dulbecco's phosphate-buffered saline. For control experiments, biotinylated nonspecific murine IgG (Jackson ImmunoResearch Laboratories Inc., West Grove, PA) was immobilized in the same fashion.

Brain Extracts. Methods for handling animals were approved by the Animal Care and Use Committee. Animals were euthanized according to animal care guidelines, and the brains were removed and frozen in liquid N2. Brains were homogenized in a Polytron homogenizer using a 9-fold milliliters-to-grams ratio of ice-cold 0.2% DEA/0.05 M NaCl (Wong et al., 2004Go). The homogenate was incubated at 0°C for 3 h and then centrifuged at 135,000g for 1 h. Supernatants were collected and stored frozen at -80°C.

Immunoprecipitation from Brain Extract. Brain extract was adjusted to pH 8.5 by adding a 1:100 dilution of 2 M Tris-HCl, pH 8.5, after which the sample was treated with three-quarters of a tablet of Complete EDTA-Free Protease Inhibitor Cocktail (Roche Applied Science, Indianapolis, IN). Proteins that bound nonspecifically to beads were removed by treating the sample with 0.8 ml of a slurry of ImmunoPure Immobilized Protein A/G beads (Pierce Chemical) and incubating it overnight at 4°C with end-over-end rotation, after which it was centrifuged to remove the beads. Next, the supernatant was treated with isotopically substituted Abeta standards (rPeptide, Bogart, GA), chosen to allow quantification of the relevant peptides. In specific experiments with animal models expressing human sequence Abeta, one or two or all of the following 15N-substituted human standards were used in the amounts: 7 ng of Abeta1–40N15, 3.5 ng of Abeta1–42N15, and 3.5 ng of Abeta1–43N15. In specific experiments with animal models expressing murine/rat sequence, 7 ng of Abeta1–40N15-substituted murine/rat standard was added. Beads loaded with Abeta-specific antibodies were then added to the sample (see above), and the samples were incubated with rotation for 24 h, after which the beads were separated from the rest of the sample by centrifugation. The beads were washed three times for 300 s each with 50 ml of ice-cold 0.2% DEA, 0.02 M Tris HCl, and 0.05 M NaCl, pH 8.5 and recovered from each wash by centrifugation at 1530g. They were then transferred to a 1.5-ml microcentrifuge tube and washed twice with 1.5 ml of ice-cold 0.02 M Tris HCl, 0.05 M NaCl, pH 8.0. Finally, the captured peptides were recovered by eluting them from the antibody beads with 50% CH3CN/0.1% trifluoroacetic acid, and the eluate was then neutralized with NH4OH.

Operational Scale of Immunoprecipitation with Different Abeta Sources. The intention of different scaling was to obtain about the same amount of Abeta for mass spectrometry from each IP experiment. With 2-week-old male Hartley guinea pigs (Charles River, Laboratories, Wilmington, MA), 30 ml of brain extract was subjected to the preclear step, and 25 ml of the supernatant was taken for IP; with 8-week-old male Sprague-Dawley rats (Charles River), 25 ml was taken for preclear step and 20 ml was taken for IP; with 12-week-old Tg2576 transgenic mice, 1.5 ml for was taken for preclear step and 1.0 ml was taken for IP; with 15-week-old male New Zealand White rabbits, 20 ml was taken for preclear step and 17.5 ml was taken for IP; and with 8-week-old male wild-type mice, 20 ml was taken for preclear step and 17.5 ml was taken for IP. H4 human neuroglioma cells (ATTC HTB-148) stably transfected with human Swedish APP were incubated for 16 h with medium at 37°C, after which the medium was collected and mixed 1:1 with 0.4% DEA/0.1 M NaCl before being stored frozen at -80°C.

MALDI-TOF MS Analysis. For each sample, the eluate containing Abeta peptides was desalted and concentrated with a C18 ZipTip (Millipore, Billerica, MA) and then mixed with the MALDI matrix {alpha}-cyano-4-hydroxycinnamic acid (Applied Biosystems, Foster City, CA). The mixture was spotted to a 192-well MALDI plate (Applied Biosystems, Foster City, CA) and analyzed using an Applied Biosystems 4700 Proteomics Analyzer, a MALDI-TOF/TOF instrument, in the linear positive ion mode. The mass range was set at 2000 to 6000 Da with the focus mass at 4300 Da. The data were collected using automatic data acquisition and a random search pattern. Each MS spectrum was an average of 10,000 laser shots with fixed laser intensity. External calibration was performed using the 4700 Cal Mix (Applied Biosystems). As appropriate for the sample, human or mouse Abeta1–40N15 added before IP was also used as an internal standard for peak intensity and mass calibration (human peptide [M+H]+ = 4383.86; mouse peptide [M+H]+ = 4285.77). Direct mass measurements of the standard peptides with the instrument in reflectron mode confirmed these values. Identifications for tissue or cell-derived peptides were based on agreement between experimental masses and theoretical values (see Results).

To provide a basis for quantitation of changes in the relative abundance of Abeta species, known amounts of 15N-substituted human or rat/mouse Abeta peptides 1 to 40, 1 to 42, and 1 to 43 were spiked into each brain extract. The ratio of peak height of each peptide to the corresponding internal standard was calculated, and the changes caused by drug treatment were estimated from the change in the ratio between the peak for each tissue-derived peptide and the most relevant internal standard.

Dosing Protocol for LY-411575. Two-week-old male Hartley guinea pigs (Charles River) were dosed subcutaneously with 3.2 mg/kg LY-411575 (Wong et al., 2004Go) using a dosage volume of 1 ml/kg. The compound was solubilized in a vehicle of 20% dimethyl sulfoxide/20% EtOH/60% polyethylene glycol 400. Guinea pigs were euthanized 3 h after dosing, and tissues were collected. There were six animals per dosing group.

Fluorescence Polarization. The experiment was performed with a Beacon 2000 instrument, using fluorescein-Abeta as the ligand to 6E10 antibody in phosphate buffer, pH 7.4.

Surface Plasmon Resonance. Surface plasmon resonance experiments were performed on a BIAcore 3000 instrument (BIAcore AB, Uppsala, Sweden). Biotinylated antibody was immobilized to 4000 resonance units on a BIAcore SA chip. Experiments were carried out at 25°C in buffer consisting of 20 mM Tris HCl, pH 8.5, and 50 mM NaCl. Abeta1–40 peptide was injected over the antibody surface and an unmodified streptavidin surface at a flow rate of 10 µl/min. Binding data were referenced against the streptavidin surface and buffer injections. Dissociation data were fit to a simple exponential using BIAeval software (BIAcore AB).


    Results
 Top
 Abstract
 Materials and Methods
 Results
 Discussion
 References
 
The monoclonal antibodies used in this work were 4G8, for which the cognate epitope is residues 17 to 24 of human or mouse/rat Abeta, and 6E10, which recognizes residues 4 to 8 of human Abeta. Conditions were sought that gave maximal depletion of the Abeta population in a single step, with capture efficiency assessed by subjecting immunodepleted samples to a second round of IP.

In a preliminary study, either 60 µg of 4G8 (Fig. 1A) or a combination of 30 µg each of 6E10 and 4G8 (Fig. 1B) efficiently captured both endogenous Abeta and the 15N-substituted human Abeta1–40 internal standard from 25-ml samples of guinea pig brain extract, but 6E10 used alone (Fig. 1C) failed to capture an N-terminally truncated form of Abeta.We elected to use a combination of the two antibodies for IP when analyzing human-like Abeta, as this method seemed most likely at the outset of the work to yield a complete Abeta profile.


Figure 1
View larger version (28K):
[in this window]
[in a new window]

 
Fig. 1. Immunoprecipitation with different antibodies. MALDI-TOF MS spectra of Abeta peptides captured from guinea pig brain extract using 60 µg of 4G8 (A); 30 µg each of 4G8 and 6E10 (B); 60 µg of 6E10 (C). The standard peptide 15N-substituted human Abeta1–40 was added to each extract before the immunoprecipitation. See Materials and Methods for other details.

 
Using 30 µg of 4G8 antibody in 25 ml of brain extract (the largest volume used) gave a 4G8 concentration of 8 nM (based on a mass of 150 kDa). The bivalent character of IgG means that its effective concentration as a capture agent is twice its molar concentration, i.e., 2 x [4G8]. If we consider the binding of 4G8 to Abeta as a simple equilibrium for which Kd = 2 x [4G8][Abeta]/[Abeta-4G8], with antibody so greatly in excess over Abeta that its free concentration [4G8] is effectively unchanged by binding all the Abeta to antibody, an endpoint at which ≥90% Abeta is bound to antibody requires that [4G8] be 5 x Kd (because [Abeta-4G8]/[Abeta] = 2 x [4G8]/Kd). Kd for the interaction of 4G8 with Abeta was reported to be 0.8 nM (Hughes et al., 1998Go), and the selected concentration of 4G8 at 8 nM (10-fold Kd) was therefore sufficient on its own according to theory, as well as appearing effective by experiment. Additional Abeta binding capacity was present in the form of an equal concentration of 6E10 antibody, for which a Kd of 1.5 nM from Abeta was measured using a fluorescence polarization assay (data not shown).

After capture, the Abeta-antibody complexes were subjected to multiple wash steps to remove nonspecifically bound components. To evaluate the risk of losing Abeta while washing, the off-rate for Abeta bound to immobilized biotinyl-6E10 was measured on a BIAcore biosensor system (data not shown). The first-order rate constant for dissociation of Abeta into the pH 8.5 wash buffer at 25°C was 3.3 x 10-4 s-1, which would result in a 10% loss in a 5-min wash. Including centrifugation, wash steps in our protocol required approximately 5 min each; however, they were performed using ice-cold buffer to retard dissociation. The available data suggested that losses by dissociation of antibody-Abeta complexes would not have had a major effect on the IP/MS profiles obtained.

Immunoprecipitation and MALDI-MS Analysis. To check the specificity of Abeta capture, guinea pig brain extract was subjected in turn to the IP protocol using i) bead-linked nonspecific IgG, followed by ii) bead-linked anti-Abeta antibodies. Before the first IP, Abeta1–40N15 was spiked into the sample as a marker for appropriately specific capture of a desired target (i.e., it should escape IP by nonspecific IgG but be captured by the anti-Abeta antibodies). Abeta1–42N15 was added to the captured sample from each round as a positive control for the MALDI-MS step.

No brain-derived Abeta or Abeta1–40N15 was captured by nonspecific IgG, because the only peak in the mass spectrum came from Abeta1–42N15 added after IP but before MS (Fig. 2A). Subsequent IP from the same extract using Abeta-specific antibodies produced a complex spectrum (Fig. 2B) in which the masses of 14 peaks matched theoretical values for Abeta peptides of the guinea pig (Table 1). Assignments of peak identity were based on experimental masses that agreed within 0.05% of theory with theoretical masses for individual Abeta species. The spectrometer was operated in linear positive ion mode to maximize its sensitivity.


Figure 2
View larger version (17K):
[in this window]
[in a new window]

 
Fig. 2. Specificity of immunoprecipitation. MALDI-TOF MS spectra of Abeta peptides captured from guinea pig brain extract by nonspecific immunoglobulin G (A) and a combination of anti-Abeta monoclonal antibodies 6E10 and 4G8 (B). The extract was probed firstly with the nonspecific antibodies and secondly with the anti-Abeta antibodies. 15N-substituted human Abeta1–40 standard peptide was added to the extract before the immunoprecipitation with nonspecific IgG, and 15N-substituted human Abeta1–42 standard peptide was added to each captured sample before mass spectrometry.

 

View this table:
[in this window]
[in a new window]

 
TABLE 1 Theoretical and observed values of [M + H]+ used to identify Abeta peptides Observed mass values were compared with theoretical average mass values for Abeta peptides. A is the human/guinea pig/rabbit/dog Abeta1–43 sequence (DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT); B is the mouse/rat Abeta1–43 sequence (differences from human Abeta are underlined) (DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT); C is the human Dutch mutant Abeta1–43 sequence (the residue altered by the mutation is underlined) (DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIAT)

 

Because the guinea pig Abeta sequence is the same as that for human, dog, and rabbit, this series of identifications applies to all four species. Table 1 also shows theoretical and experimental mass values for Abeta of the mouse and rat and for Dutch variant human peptides, which appear later under Results.

Abeta Peptide Profiles from Model Species. Despite the sequence-identity of guinea pig, dog, and rabbit Abeta, there is no certainty that the {alpha}-, beta-, and {gamma}-secretase enzymes in these species will cleave APP at similar rates or with similar relative specificities for different cleavage sites. Differences in degradation or clearance of Abeta could also cause interspecies variation in Abeta populations. In Fig. 3, MALDI-TOF MS profiles of Abeta are given for brain extracts of the guinea pig, dog, and rabbit (each equivalent to 2.7 g of brain tissue). The three samples gave profiles in which the principal similarities are the prominence of Abeta species 11 to 34, 11 to 40, 1 to 33, 1 to 34, 1 to 37, 1 to 38, 1 to 40, and 1 to 42. Abeta1–43 was also detected in all three extracts. Differences were comparatively minor and included the peak identified as Abeta7–39 in the dog sample. The guinea pig has been recommended as an animal model for human APP/Abeta processing because of its human-identical Abeta, whereas the dog is favored for drug safety evaluation.


Figure 3
View larger version (34K):
[in this window]
[in a new window]

 
Fig. 3. MALDI-TOF MS analysis of Abeta peptides from three sources of human-identical Abeta peptides. A, guinea pig brain with 15N-substituted human internal standards for Abeta1–40, Abeta1–42, and Abeta1–43. B, dog brain with 15N-substituted human internal standards for Abeta1–40 and Abeta1–42. C, rabbit brain with 15N-substituted human internal standards for Abeta1–40, Abeta1–42, and Abeta1–43. 15N-Substituted internal standards were added to the extracts before immunoprecipitation.

 

Wild-Type and Transgenic Mice. We next examined Abeta populations from three mouse models containing different APP substrates: wild-type mouse with its endogenous APP, as well as transgenic mice expressing either the Swedish or Dutch mutant forms of human APP (Fig. 4). Because the wild type mouse has three differences in Abeta peptide sequence compared with human Abeta (see Table 1), the human Abeta-specific antibody 6E10 does not capture murine Abeta, and so IP from the extract of wild-type mouse brain was performed with 4G8 alone. The transgenic mouse samples were probed with both 4G8 and 6E10 antibodies. Due to the different levels of total Abeta in these mouse models, the amount of brain extract used for IP was adjusted accordingly. For mouse brain, 1.8 g was subjected to IP compared with 1.17 g of Dutch-mutant mouse brain and 0.11 g of Tg2576 mouse brain. In the Swedish mutant, a two-residue sequence change from wild-type immediately N-terminal to the BACE site enhanced the rate of Abeta cleavage, causing an elevated ratio of Abeta production to cleavage at the {alpha}-secretase site (Citron et al., 1992Go). In the Dutch variant, alteration of Glu-22 to Gln-22 increases the propensity of the Abeta population to form fibrils (Watson et al., 1999Go).


Figure 4
View larger version (32K):
[in this window]
[in a new window]

 
Fig. 4. MALDI-TOF MS analysis of Abeta peptides immunoprecipitated from brain extracts of three mouse strains. A, endogenous Abeta of wild-type mouse with 15N-substituted murine/rat internal standards for Abeta1–40. Mouse Abeta species are designated m1–40, etc., to distinguish them from the human-identical forms. B, Abeta peptides from transgenic mouse Tg2576, which expresses the Swedish mutant form of human APP; the Abeta species captured are predominantly human, including the 15N-substituted human internal standards for Abeta1–40, Abeta1–42, and Abeta1–43. C, Abeta peptides from transgenic mouse expressing Dutch mutant APP, in which Glu-22 of Abeta1–40 is altered to Gln-22, causing a 1-Da mass decrease, with 15N-substituted human internal standards for Abeta1–40 and Abeta1–42. Both human and mouse Abeta species were detected. Dutch mutant human peptides are designated D1–40, etc.

 
Brain extract from wild-type mouse gave an Abeta pattern (Fig. 4A) distinct from that seen in guinea pig, rabbit, and dog. Its major feature was the prevalence of Abeta peptides with N-terminal Glu-11 (Gouras et al., 1998Go). In contrast to the profiles shown in Fig. 3, Abeta peptides 11 to 34, 11 to 37, 11 to 38, and 11 to 40 yielded prominent peaks, and peaks for Abeta1–40 and Abeta1–42 were comparatively less abundant. This was not the case for spectra from brains of transgenic mice expressing Swedish-variant (Fig. 4B) and Dutch-variant (Fig. 4C) human APP, which resembled that of wild-type guinea pig (Fig. 3A) much more than that of wild-type mouse (Fig. 4A). Both transgenic profiles were dominated by peaks of C-terminally truncated Abeta, including Abeta1–37, Abeta1–38, Abeta1–40, and Abeta1–42, with relatively few Abeta11–x components. The result clearly indicates how heavily minor differences in the Abeta sequence can alter the product profile. Abeta1–43 was not detected in any mouse models, including wild-type or human transgene-expressing models. This could be due to either a low abundance or lack of cleavage of this fragment in these models.

Transgene-derived human Abeta dominated the profile from Tg2576 mouse (Fig. 4B), with no detection of Abeta sourced from mouse APP. The Tg2576 model has a 6-fold higher expression of the human APP protein relative to the endogenous mouse APP, and this level of expression of the Swedish-mutation variant of APP resulted in the production of a 5-fold increase in the amount of Abeta1–40 and a 14-fold higher amount of Abeta1 to 42 relative to endogenous murine Abeta (Hsiao et al., 1996Go). The failure to detect murine Abeta can be accounted for by recalling that 16-fold less brain tissue was used from the Tg2576 mouse than from wild type to compensate for the robust overexpression of human Abeta in this model. In contrast to the profile from the Tg2576 mice, endogenous mouse Abeta peptides were clearly represented in the spectrum from the transgenic mouse expressing Dutch-variant human APP (Fig. 4C), a line that has approximately a 5-fold increase in APP expression and an approximate 4-fold excess of human Abeta relative to murine (Fig. 4C). The quantity of brain tissue extracted for the Dutch-variant transgene was 69% of that taken for wild-type mouse. The peak profile of endogenous mouse Abeta from Dutch-mutant mouse (Fig. 4C) was consistent with the profile from wild-type mouse (Fig. 3A), with prominent Abeta11–x peaks (mouse Abeta11–34, Abeta11–38, and Abeta11–40). The striking feature of the results from Dutchvariant mouse is coexistent within a single brain of different processing patterns for the mouse and human APPs. On a technical point, the murine Abeta profile obtained from mice carrying the Dutch variant APP transgene by IP using both monoclonals generally matched the profile captured from wild-type mice by 4G8 alone. This mitigates any concern that use of 4G8 alone might skew the profile in favor of Abeta11–x components.

Abeta Secreted from Human Cells. Stably transfected cell lines that produce Abeta are also used in AD research. Figure 5 shows MALDI-TOF MS profiles for Abeta secreted from H4 human neuroglioma cells stably transfected with either wild-type human APP (Fig. 5A) or Swedish-variant APP (Fig. 5B). In each case, Abeta was immunoprecipitated from cell-conditioned medium with 6E10 and 4G8 antibodies. A notable difference between the profiles is the relative loss of Abeta11–x peptides in the H4Sw/APP-conditioned medium (Fig. 5B), which can be attributed to the previously detected influence of the Swedish mutation on the relative rates of cleavage before Asp-1 and Glu-11 of Abeta. The spectra in Fig. 5, together with those from the Tg2576 mouse brain (Fig. 4B), support the view that the Swedish mutation favors production of Abeta1–x relative to other potential events (e.g., {alpha}-secretase-catalyzed cleavage or production of Abeta11–x) (Citron et al., 1994Go) and also imply that BACE may cleave before either Asp-1 or Glu-11 but not function sequentially at both sites.


Figure 5
View larger version (19K):
[in this window]
[in a new window]

 
Fig. 5. MALDI-TOF MS analysis of Abeta peptides immunoprecipitated from conditioned medium of human cells. A, H4 human cells expressing wild-type human APP with 15N-substituted human internal standards for Abeta1–40. B, H4 human cells expressing Swedish-mutant variant human APP with 15N-substituted human internal standards for Abeta1–40, Abeta1–42, and Abeta1–43.

 
Comparison of Wild-Type Rodent Profiles. Figure 6 compares profiles from rodents commonly used to study Abeta production. These include the guinea pig (Fig. 6A), which produces human-identical Abeta peptides, the wild-type mouse (Fig. 6B), and the wild-type rat (Fig. 6C). Mouse and rat generate almost identical Abeta products that differ from the human sequence at three positions. The result of the comparison is clear. The species that produce human-identical Abeta species give profiles in which Abeta1–34 and Abeta1–40 are the largest peaks, whereas the mouse and rat profiles are dominated by Abeta peptides beginning at Glu-11 of the Abeta1–40 sequence.


Figure 6
View larger version (33K):
[in this window]
[in a new window]

 
Fig. 6. MALDI-TOF MS analysis of Abeta peptides immunoprecipitated from brain extracts of three rodent species. A, guinea pig with 15N-substituted human internal standards for Abeta1–40, Abeta1–42, and Abeta1–43. B, mouse (wild-type) with 15N-substituted murine/rat internal standards for Abeta1–40. C, rat with 15N-substituted murine/rat internal standards for Abeta1–40.

 
Quantitative Analysis of Drug Effects on Abeta Peptide Production in Guinea Pig Brain. The ability to detect and identify individual Abeta peptides in a complex pool should allow the evaluation of drug effects on individual peptides in model species. Drug action is quantified by noting how peaks from tissue-derived Abeta change in comparison with peaks for internal standards, which were added at constant levels to all brain extracts. Multiple internal standards allowed more precise quantitation of specific Abeta peptides. The initial selection of internal standards Abeta1–40N15 and Abeta1–42N15 to calibrate the corresponding endogenous Abeta1–40 and Abeta1–42 in guinea pig brain extracts was based on their known importance and disease relevance and the greater variability that might be expected for longer and more hydrophobic Abeta products. The Abeta1–40N15 peptide also served as internal standard for shorter Abeta peptides, because it was not feasible to have an independent standard for every Abeta in the pool.

Figure 7 shows the effect of a 3.2 mg/kg dose of a {gamma}-secretase inhibitor LY-411575 (Eli Lilly & Co., Indianapolis, IN), on the Abeta profile from guinea pig brain (see Materials and Methods for details). LY-411575 generally inhibited production of Abeta in guinea pig brain, with most fragments declining as gauged by their peak intensity relative to the internal standards. An exception was the elevation of Abeta1–43, which appeared to be an increase of severalfold by reference to the both the Abeta-40N15 and Abeta1–42N15 internal standards. Although a corresponding Abeta1–43 internal standard was not included in this experiment, the robust increase in endogenous Abeta1–43 is readily quantified with the two internal standards present, and subsequent experiments prove that employing all three internal standards would not change the outcome of this experiment. Effects of this kind would be difficult to detect without the capacity of mass spectrometry to survey the Abeta population.


Figure 7
View larger version (21K):
[in this window]
[in a new window]

 
Fig. 7. Effect of the {gamma}-secretase inhibitor LY-411575 on the Abeta peptide population recovered from guinea pig brain 3 h after dosing. Guinea pigs were dosed subcutaneously with vehicle (A) and LY-411575 (B) at 3.2 mg/kg. Extraction, addition of 15N-substituted human internal standards for Abeta1–40 and Abeta1–42, and immunoprecipitation were performed as described under Materials and Methods.

 

    Discussion
 Top
 Abstract
 Materials and Methods
 Results
 Discussion
 References
 
Animal models are indispensable in AD research, but applications of IP/MS have largely been confined to characterizing Abeta in human brain (Huse et al., 2002Go), in cerebrospinal fluid of AD patients (Lewczuk et al., 2003Go; Portelius et al., 2006Go), or in conditioned media from cells transfected with genes encoding human APP (Wang et al., 1996Go; Vandermeeren et al., 2001Go). There have been fewer studies of Abeta populations in animal brains (Terai et al., 2001Go; Lewis et al., 2004Go; Rufenacht et al., 2005Go), despite the potential value of such data in interpreting the properties of important models and the actions of drug candidates.

Because different Abeta peptides contribute differently to neurotoxic insult and plaque formation (Parvathy et al., 2001Go), understanding interspecies differences in Abeta peptide production should help to rationalize differences among different in vivo models. In addition, the enzymology of {gamma}-secretase includes subtle responses to pharmacologic intervention, such as uneven shifts in the relative quantities of particular Abeta peptides (Ikeuchi et al., 2003Go; Beher et al., 2004Go). As a profiling method, IP/MS offers an excellent approach to both these subjects.

The most favored animal models are transgenic mice that overexpress mutant or wild-type human APP and exhibit amyloid deposits. They express both human and mouse APP at different ratios in the presence of either endogenous murine PS1 [the Tg2576 mouse (Hsiao et al., 1996Go)] or transgenic human PS1 [the PSAPP mouse (Takeuchi et al., 2000Go)]. The three differences in sequence between human and mouse Abeta cause profound differences among their respective biophysical properties and propensities to form oligomers and plaques (De Strooper et al., 1995Go). IP/MS was used here to analyze whether Abeta profiles from transgenic mice expressing different forms of human APP had more resemblance to those from animals that make human-identical Abeta or to those from animals that make wild-type rat/mouse Abeta.

The low level of Abeta in brains of animals lacking an APP transgene provided a technical challenge. Our method was designed to capture and detect even minor Abeta species from relatively large amounts of brain extract for the purpose of thorough characterization of Abeta in animal brains, including both extracellular and intracellular forms. It clearly detected the fragments already implicated in AD, as well as recognizing several Abeta fragments not reported elsewhere (to our knowledge). As a critical step, components that bound nonspecifically to IgG were removed before specific Abeta capture, minimizing interference with capture and mass analysis.

Abeta profiles from brain extracts of guinea pig, dog, and rabbit, three species that make human-identical Abeta (Johnstone et al., 1991Go), were similar (Fig. 3) except for a small peak of Abeta7–39 from dog brain. The longer Abeta forms identified were Abeta1–40, Abeta1–42, and Abeta1–43. Another major peak was Abeta1–34; cleavage of -Leu34-Met35- in Abeta is attributed to BACE (Shi et al., 2003Go). The peptide profile from untreated guinea pig was consistent across all experiments (Figs. 3, 6, and 7), demonstrating the reproducibility of the pattern of Abeta peptides obtained with this methodology.

To gauge how different APP sequences affected Abeta profiles, we next analyzed brain Abeta from wild-type mice and two transgenic lines expressing mutant human APP (Fig. 4). The transgenics were i) Tg2576 mice, expressing Swedish-variant human APP, and ii) mice expressing Dutch-variant human APP (in which Glu-22 of Abeta becomes Gln-22). All three lines produce Abeta by activity of endogenous mouse secretases. IP/MS of wild-type mouse brain showed the preponderance of Abeta11–x species reported earlier (Gouras et al., 1998Go); cleavage of -Phe10-Glu11- in mouse/rat Abeta is attributed to BACE1 (Vassar et al., 1999Go). Each transgenic model produced a distinctive profile. That from Tg2576 brain was dominated by human-sequence Abeta and resembled the guinea pig, dog, and rabbit profiles. Dutch-variant APP mouse gave a complex profile containing human and murine Abetas, but peaks from each APP were easily assigned to their respective Abeta sequences. The Abeta profile derived from murine APP matched the one from wild-type mouse, and the Abeta profile from the Dutch-type human APP was generally similar to the one from animals containing human-identical Abeta.

Comparing profiles from the three mouse models again suggested that it was the APP substrate (presumably its sequence in the Abeta and pre-Abeta regions) rather than host secretase and Abeta-degrading enzymes that determined the Abeta profile. Further support came from comparing the native Abeta profiles of three different rodent species (Fig. 6). The similar Abeta profiles of mouse (Fig. 6B) and rat (Fig. 6C) were dominated by peaks of rat/mouse Abeta11–34 and Abeta11–40 and were distinct from the guinea pig profile (Fig. 6A), with major peaks of Abeta1–40 and Abeta1–34.

The Abeta population secreted from H4 cells expressing wild-type human APP included a strong peak of Abeta11–40 (Fig. 5A); however, Abeta11–40 was barely detected in medium conditioned by cells expressing Swedish variant (Fig. 5B). This presumably reflected the enhanced kinetics of cleavage at the Abeta N terminus with Swedish-variant APP as substrate. Tg2576 mice, which express the Swedish human variant, as well as H4 cells overexpressing Swedish-variant APP, produced a profile dominated by Abeta1–40, with almost no Abeta cleaved after Tyr-10. This was consistent with the report that skin fibroblasts from persons of the Swedish pedigree secreted elevated levels of Abeta, with peptides starting at Abeta1 predominant (Citron et al., 1994Go).

BACE and {gamma}-secretase are drug targets in AD, and IP/MS profiling could apply to either approach. Surprisingly, the more complex {gamma}-secretase has yielded more quickly to medicinal chemistry in terms of getting trial agents to the clinic. To us and others (Beck et al., 2003Go), the guinea pig has attractions as a preclinical model that include its human-like brain Abeta profile (e.g., compare Figs. 5A and 6A). This made it interesting to test the effects of a {gamma}-secretase inhibitor on the Abeta profile from guinea pig brain.

IP/MS is unique in distinguishing so many different Abeta fragments, and the use of 15N-substituted Abeta standards allows quantitative assessment of drug effects on all brain Abeta peptides simultaneously. A {gamma}-secretase inhibitor, LY-411575, was shown to have induced acute changes in the guinea pig brain Abeta profile 3 h after the animal received a subcutaneous dose of 3.2 mg/kg (Fig. 7). Abeta1–40 and Abeta1–42 were both diminished in abundance relative to their specific internal standards. The other Abeta fragments were also diminished, including Abeta1–34, a product of two BACE-catalyzed cleavages. This phenomenon was interpreted elsewhere as signifying that {gamma}-secretase must cleave the CT99 fragment of APP before BACE cleaves after Leu-34 (Shi et al., 2003Go). It was also observed that the {gamma}-secretase inhibitor diminished some fragments more than others, which adds further complexity to the process of secretase inhibition. Of particular interest, the Abeta1–43 fragment was increased more than 2-fold over vehicle levels in drug-dosed animals. We have replicated this result in a second experiment (data not shown). Similar results were observed with cellular systems (Ikeuchi et al., 2003Go; Qi-Takahara et al., 2005Go) but have not (to our knowledge) been reported before in animal brain. The importance of Abeta1–43 is not fully understood, but its strongly amyloidogenic nature presumably makes it undesirable (Burdick et al., 1992Go; Jarrett et al., 1993Go). Consistent with this, Abetax–42 and Abetax--43 were shown to be associated with early AD progression in human patients (Parvathy et al., 2001Go). This result underlines the complexity of the task of pharmacologically inhibiting Abeta processing through secretase inhibition, reinforcing the importance of thoroughly studying the Abeta profile in animal models. As we detected Abeta1–43 only in animal models endogenously expressing the human Abeta sequence (and flanking sequence), the proper selection of animal models and detailed Abeta profiling may promote understanding the effects of secretase inhibitors and their potential impact in human brain.

Judging by the Abeta profiles presented here for in vivo models and in vitro models, the APP sequence is the principal factor governing the Abeta profile. According to the amyloid hypothesis, the production and toxic effects of Abeta peptides are the primary cause of neurotoxicity and consequent cell death in the brain. The impossibility of direct biochemical analyses on brain tissue from living patients makes it immensely important that animal models of the disease be chosen based on maximal information. A thorough understanding of species differences in Abeta peptide production will enhance our understanding of in vivo models and thereby promote efforts to defeat AD. The IP/MS described above revealed the complexity of APP processing in different species. The unexpected observation of enhanced production of Abeta1–43 caused by a {gamma}-secretase inhibitor further emphasized the importance of thoroughly assessing the response to drug treatment at a high level of detail. That this result is obtained in an animal model that closely resembles Abeta processing in the normal human brain underlines the importance of attempting to gauge the medical potential of emerging pharmaceutical Abeta modifiers in a human-like biological context.


    Acknowledgements
 
We acknowledge the assistance from Tracy M. Brown, Thomas Lanz, Christy Andrews, Don Tyskiewicz, Charles Nolan, Karl Richter, Qing Fei, and Jim Finley.


    Footnotes
 
Article, publication date, and citation information can be found at http://jpet.aspetjournals.org.

doi:10.1124/jpet.106.114561.

ABBREVIATIONS: Abeta, beta-amyloid; AD, Alzheimer's disease; APP, amyloid precursor protein; BACE, beta-amyloid-converting enzyme or beta-secretase; DEA, diethylamine; MALDI-TOF MS, matrix-assisted laser desorption time-of-flight mass spectrometry; IP, immunoprecipitation; IP/MS, immunoprecipitation followed by mass spectrometry; Tg, transgenic; Abeta1-40N15, 15N-substituted Abeta1–40; PS, presenilin; PS1, presenilin-1; PS2, presenilin-2; LY411575, N2-[(2S)-2-(3,5-difluorophenyl)-2-hydroxyethanoyl]-N1[(7S)-5-methyl-6-oxo-6,7-dihydro-5H-dibenzo[bid]azepin-7yl]-L-alaninamide.

Address correspondence to: Barbara Tate, Pfizer, Inc., Eastern Point Rd., MS# 8220-4070, Groton, CT 06340. E-mail: barbara.tate{at}pfizer.com


    References
 Top
 Abstract
 Materials and Methods
 Results
 Discussion
 References
 

Beck M, Bigl V, and Rossner S (2003) Guinea pigs as a nontransgenic model for APP processing in vitro and in vivo. Neurochem Res 28: 637-644.[CrossRef][Medline]

Beher D, Clarke EE, Wrigley JDJ, Martin ACL, Nadin A, Churcher I, and Shearman MS (2004) Selected non-steroidal anti-inflammatory drugs and their derivatives target {gamma}-secretase at a novel site: evidence for an allosteric mechanism. J Biol Chem 279: 43419-43426.[Abstract/Free Full Text]

Burdick D, Soreghan B, Kwon M, Kosmoski J, Knauer M, Henschen A, Yates J, Cotman C, and Glabe C (1992) Assembly and aggregation properties of synthetic Alzheimer's A4/beta amyloid peptide analogs. J Biol Chem 267: 546-554.[Abstract/Free Full Text]

Chyung JH, Raper DM, and Selkoe DJ (2005) {gamma}-Secretase exists on the plasma membrane as an intact complex that accepts substrates and effects intramembrane cleavage. J Biol Chem 280: 4383-4392.[Abstract/Free Full Text]

Citron M, Diehl TS, Gordon G, Biere AL, Seubert P, and Selkoe DJ (1996) Evidence that the 42- and 40-amino acid forms of amyloid beta protein are generated from the beta-amyloid precursor protein by different protease activities. Proc Natl Acad Sci USA 93: 13170-13175.[Abstract/Free Full Text]

Citron M, Oltersdorf T, Haass C, McConlogue L, Hung AY, Seubert P, Vigo-Pelfrey C, Lieberburg I, and Selkoe DJ (1992) Mutation of the beta-amyloid precursor protein in familial Alzheimer's disease increases beta-protein production. Nature (Lond) 360: 672-674.[CrossRef][Medline]

Citron M, Vigo-Pelfrey C, Teplow DB, Miller C, Schenk D, Johnston J, Winblad B, Venizelos N, Lannfelt L, and Selkoe DJ (1994) Excessive production of amyloid beta-protein by peripheral cells of symptomatic and presymptomatic patients carrying the Swedish familiar Alzheimer Disease mutation. Proc Natl Acad Sci USA 91: 11993-11997.[Abstract/Free Full Text]

Clark RF, Hutton M, Fuldner M, Froelich S, Karran E, Talbot C, Crook R, Lendon C, Prihar G, He C, et al. (1995) The structure of the presenilin 1 (S182) gene and identification of six novel mutations in early onset AD families. Nat Genet 11: 219-222.[CrossRef][Medline]

De Strooper B, Simons M, Multhaup G, Van Leuven F, Beyreuther K, and Dotti CG (1995) Production of intracellular amyloid-containing fragments in hippocampal neurons expressing human amyloid precursor protein and protection against amyloidogenesis by subtle amino acid substitutions in the rodent sequence. EMBO (Eur Mol Biol Organ) J 14: 4932-4938.[Medline]

Edbauer D, Kaether C, Steiner H, and Haass C (2004) Co-expression of nicastrin and presenilin rescues a loss of function mutant of APH-1. J Biol Chem 279: 37311-37315.[Abstract/Free Full Text]

Gandy S (2005) The role of cerebral amyloid beta accumulation in common forms of Alzheimer disease. J Clin Investig 115: 1121-1129.[CrossRef][Medline]

Gao Y and Pimplikar SW (2001) The {gamma}-secretase-cleaved C-terminal fragment of amyloid precursor protein mediates signaling to the nucleus. Proc Natl Acad Sci USA 98: 14979-14984.[Abstract/Free Full Text]

Gouras GK, Xu H, Jovanovic JN, Buxbaum JD, Wang R, Greengard P, Relkin NR, and Gandy S (1998) Generation and regulation of beta-amyloid peptide variants by neurons. J Neurochem 71: 1920-1925.[Medline]

Haniu M, Denis P, Young Y, Mendiaz EA, Fuller J, Hui JO, Bennett BD, Kahn S, Ross S, Burgess T, et al. (2000) Characterization of Alzheimer's beta-secretase protein BACE. A pepsin family member with unusual properties. J Biol Chem 275: 21099-21106.[Abstract/Free Full Text]

Hong L, Koelsch G, Lin X, Wu S, Terzyan S, Ghosh AK, Zhang XC, and Tang J (2000) Structure of the protease domain of memapsin 2 (beta-secretase) complexed with inhibitor. Science (Wash DC) 290: 150-153.[Abstract/Free Full Text]

Hsiao K, Chapman P, Nilsen S, Eckman C, Harigaya Y, Younkin S, Yang FS, and Cole G (1996) Correlative memory deficits, Abeta elevation, and amyloid plaques in transgenic mice. Science (Wash DC) 274: 99-102.[Abstract/Free Full Text]

Hughes SR, Khorkova O, Goyal S, Knaeblein J, Heroux J, Riedel NG, and Sahasrabudhe S (1998) {alpha}2-Macroglobulin associates with beta-amyloid peptide and prevents fibril formation. Proc Natl Acad Sci USA 95: 3275-3280.[Abstract/Free Full Text]

Huse JT, Liu K, Pijak DS, Carlin D, Lee VMY, and Doms RW (2002) beta-Secretase processing in the trans-Golgi network preferentially generates truncated amyloid species that accumulate in Alzheimer's disease brain. J Biol Chem 277: 16278-16284.[Abstract/Free Full Text]

Ikeuchi T, Dolios G, Kim S-H, Wang R, and Sisodia SS (2003) Familial Alzheimer disease-linked presenilin 1 variants enhance production of both Abeta1–40 and Abeta1–42 peptides that are only partially sensitive to a potent aspartyl protease transition state inhibitor of "{gamma}-Secretase". J Biol Chem 278: 7010-7018.[Abstract/Free Full Text]

Jarrett JT, Berger EP, and Lansbury PT Jr (1993) The carboxyl terminus of the beta amyloid protein is critical for the seeding of amyloid formation: implications for the pathogenesis of Alzheimer's disease. Biochemistry 32: 4693-4697.[CrossRef][Medline]

Johnstone EM, Chaney MO, Norris FH, Pascual R, and Little SP (1991) Conservation of the sequence of the Alzheimer's disease amyloid peptide in dog, polar bear and five other mammals by cross-species polymerase chain reaction analysis. Brain Res Mol Brain Res 10: 299-305.[Medline]

Landman N and Kim TW (2004) Got RIP? Presenilin-dependent intramembrane proteolysis in growth factor receptor signaling. Cytokine Growth Factor Rev 15: 337-351.[CrossRef][Medline]

Lewczuk P, Esselmann H, Meyer M, Wollscheid V, Neumann M, Otto M, Maler JM, Ruther E, Kornhuber J, and Wiltfang J (2003) The amyloid-beta (Abeta) peptide pattern in cerebrospinal fluid in Alzheimer's disease: evidence of a novel carboxyterminally elongated Abeta peptide. Rapid Commun Mass Spectrom 17: 1291-1296.[CrossRef][Medline]

Lewis HD, Beher D, Smith D, Hewson L, Cookson N, Reynolds DS, Dawson GR, Jiang M, Van der Ploeg JHX, Qian S, et al. (2004) Novel aspects of accumulation dynamics and AP composition in transgenic models of AD. Neurobiol Aging 25: 1175-1185.[CrossRef][Medline]

Miravalle L, Calero M, Takao M, Roher AE, Ghetti B, and Vidal R (2005) Aminoterminally truncated Abeta peptide species are the main component of cotton wool plaques. Biochemistry 44: 10810-10821.[CrossRef][Medline]

Naslund J, Jensen M, Tjernberg LO, Thyberg J, Terenius L, and Nordstedt C (1994) The metabolic pathway generating p3, an Abeta-peptide fragment, is probably nonamyloidogenic. Biochem Biophys Res Commun 204: 780-787.[CrossRef][Medline]

Parvathy S, Davies P, Haroutunian V, Purohit DP, Davis KL, Mohs RC, Park H, Moran TM, Chan JY, and Buxbaum JD (2001) Correlation between Abetax-40-, Abetax-42-, and Abetax-43-containing amyloid plaques and cognitive decline. Arch Neurol 58: 2025-2031.[Abstract/Free Full Text]

Portelius E, Westman-Brinkmalm A, Zetterberg H, and Blennow K (2006) Determination of beta-amyloid peptide signatures in cerebrospinal fluid using immunoprecipitation-mass spectrometry. J Proteome Res 5: 1010-1016.[CrossRef][Medline]

Qi-Takahara Y, Morishima-Kawashima M, Tanimura Y, Dolios G, Hirotani N, Horikoshi Y, Kametani F, Maeda M, Saido TC, Wang R, et al. (2005) Longer forms of amyloid beta protein: Implications for the mechanism of intramembrane cleavage by {gamma}-secretase. J Neurosci 25: 436-445.[Abstract/Free Full Text]

Rufenacht P, Guntert A, Bohrmann B, Ducret A, and Dobeli H (2005) Quantification of the Abeta peptide in Alzheimer's plaques by laser dissection microscopy combined with mass spectrometry. J Mass Spectrom 40: 193-201.[CrossRef][Medline]

Shi X-P, Tugusheva K, Bruce JE, Lucka A, Wu G-X, Chen-Dodson E, Price E, Li Y, Xu M, Huang Q, et al. (2003) beta-Secretase cleavage at amino acid residue 34 in the amyloid beta peptide is dependent upon {gamma}-secretase activity. J Biol Chem 278: 21286-21294.[Abstract/Free Full Text]

Takeuchi A, Irizarry MC, Duff K, Saido TC, Hsiao Ashe K, Hasegawa M, Mann DMA, Hyman BT, and Iwatsubo T (2000) Age-related amyloid beta deposition in transgenic mice overexpressing both Alzheimer mutant presenilin 1 and amyloid beta precursor protein Swedish mutant is not associated with global neuronal loss. Am J Pathol 157: 331-339.[Abstract/Free Full Text]

Terai K, Iwai A, Kawabata S, Tasaki Y, Watanabe T, Miyata K, and Yamaguchi T (2001) beta-Amyloid deposits in transgenic mice expressing human beta-amyloid precursor protein have the same characteristics as those in Alzheimer's disease. Neurosci 104: 299-310.[CrossRef][Medline]

Vandermeeren M, Geraerts M, Pype S, Dillen L, Van Hove C, and Mercken M (2001) The functional {gamma}-secretase inhibitor prevents production of amyloid beta 1–34 in human and murine cell lines. Neurosci Lett 315: 145-148.[CrossRef][Medline]

Vassar R, Bennett BD, Babu-Khan S, Kahn S, Mendiaz EA, Denis P, Teplow DB, Ross S, Amarante P, Loeloff R, et al. (1999) beta-Secretase cleavage of Alzheimer's amyloid precursor protein by the transmembrane aspartic protease BACE. Science (Wash DC) 286: 735-741.[Abstract/Free Full Text]

Wang R, Sweeney D, Gandy SE, and Sisodia SS (1996) The profile of soluble amyloid beta protein in cultured cell media. Detection and quantification of amyloid beta protein and variants by immunoprecipitation-mass spectrometry. J Biol Chem 271: 31894-31902.[Abstract/Free Full Text]

Watson D, Castano E, Kokjohn TA, Kuo Y-M, Lyubchenko Y, Pinsky D, Connolly ES Jr, Esh C, Luehrs DC, Stine WB, et al. (2005) Physicochemical characteristics of soluble oligomeric Abeta and their pathologic role in Alzheimer's disease. Neurol Res 27: 869-881.[CrossRef][Medline]

Watson DJ, Selkoe DJ, and Teplow DB (1999) Effects of the amyloid precursor protein Glu693->Gln "Dutch" mutation on the production and stability of amyloid beta-protein. Biochem J 340: 703-709.

Wong GT, Manfra D, Poulet FM, Zhang Q, Josien H, Bara T, Engstrom L, Pinzon-Ortiz M, Fine JS, Lee HJJ, et al. (2004) Chronic treatment with the {gamma}-secretase inhibitor LY-411,575 inhibits beta-amyloid peptide production and alters lymphopoiesis and intestinal cell differentiation. J Biol Chem 279: 12876-12882.[Abstract/Free Full Text]

Zhao G, Mao G, Tan J, Dong Y, Cui M-Z, Kim S-H, and Xu X (2004) Identification of a new presenilin-dependent {{zeta}}-cleavage site within the transmembrane domain of amyloid precursor protein. J Biol Chem 279: 50647-50650.[Abstract/Free Full Text]



This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow All Versions of this Article:
jpet.106.114561v1
320/3/1144    most recent
Right arrow Submit a response
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Citing Articles
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Du, P.
Right arrow Articles by Geoghegan, K. F.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Du, P.
Right arrow Articles by Geoghegan, K. F.


Home Help [Feedback] [For Subscribers] [Archive] [Search] [Contents]
All ASPET Journals Molecular Pharmacology Pharmacological Reviews
 Molecular Interventions Drug Metabolism and Disposition