![]() |
|
|
Vol. 299, Issue 3, 1021-1026, December 2001
Amgen Inc., Neuroscience, Thousand Oaks, California (A.W.B., J.S., M.C., J.M.F., J.D.); and Amgen Boulder Inc., Peptide Chemistry, Longmont, Colorado (M.A.J.)
| |
Abstract |
|---|
|
|
|---|
Cocaine- and amphetamine-regulated transcript (CART) encodes a neuropeptide precursor protein that is highly abundant in cells of the hypothalamus. To date, the major research focus into the function of CART peptides has been feeding behavior. However, CART mRNA is found in other areas of the brain as well as some peripheral tissues, suggesting possible broader functions of this peptide. In this study, we investigated the effects of two CART peptides, CART 42-89 and CART 49-89, in several behavioral assays. Peptides were administered by i.c.v. route of administration. Both CART 42-89 and CART 49-89 inhibited food intake with the minimally effective dose of CART 42-89 (0.5 µg) being 5-fold greater than that of CART 49-89 (0.1 µg). Both peptides also produced significant antinociceptive effects in the hot-plate assay with similar potency differences. CART 42-89 significantly inhibited the acoustic startle response (ASR) of pulse alone trials at doses of 0.1 and 0.5 µg. In contrast, CART 49-89 did not affect ASR of pulse alone trials at doses of 0.05 and 0.1 (µg). For prepulse inhibition (PPI) trials, in general, both peptides appeared to enhance the magnitude of PPI and CART 42-89 was less potent than CART 49-89. Overall, these data suggest CART peptides may have multiple roles in central nervous system function and there may be biological differences between two processed forms of CART peptide.
| |
Introduction |
|---|
|
|
|---|
Cocaine- and
amphetamine-regulated transcript (CART) is a putative neuropeptide
precursor protein possibly involved in the regulation of ingestive
behaviors (Kristensen et al., 1998
). Two C-terminal CART-derived
peptides, CART 42-89 and CART 49-89, have been isolated from rat
hypothalamus and arcuate nucleus as well as the pituitary (Thim et al.,
1999
). Both peptides result from proteolytic cleavage events at dibasic
residues (KR and KK, respectively) within the CART peptide precursor
and thus represent potential biologically active neuropeptides.
Intracerebroventricular (i.c.v.) administration of CART 42-89
decreases food intake in normal and in fasted rats (Kristensen et al.,
1998
; Vrang et al., 1999
). After i.c.v. administration of CART peptide,
there is an induction of c-fos mRNA expression levels in brain areas
normally associated with control of feeding behavior and energy balance
(Vrang et al., 1999
, 2000
). In addition, CART mRNA expression levels
are modulated by different states of energy balance as well as leptin levels (Kristensen et al., 1998
; Ahima et al., 1999
). The high level of
CART mRNA expressed in the hypothalamus (Douglass et al., 1995
) also
supports a role for CART-derived peptides in the modulation of feeding behavior.
Although the hypothalamus is enriched with CART mRNA, in situ
hybridization shows endogenous CART mRNA in other brain areas and
peripheral tissues (Couceyro et al., 1997
). Overall, most of these data
indicate that CART peptide(s) is likely involved as a neuroendocrine
modulator. However, as evidenced by the original discovery that showed
up-regulation of CART mRNA in rat striatum after cocaine and
amphetamine administration (Douglass et al., 1995
), CART peptides may
serve even broader functions. For example, there are published data
indicating that CART peptide may produce an anxiogenic effect in rats
(Kask et al., 2000
) and that intrathecal administration of CART peptide
in mice produces a hyperalgesic effect (Ohsawa et al., 2000
). Based on
the anatomical distribution of CART mRNA and peptides, it is speculated
CART peptide may play a role in sensory processing as well as autonomic
regulation (Couceyro et al., 1997
; Koylu et al., 1998
).
In the present investigation, the effects of two C-terminal
CART-derived peptides, 42-89 and 49-89, were determined on several behavioral measures in mice, including those associated with sensory processing. These peptides were chosen because they appear to be the
most abundant forms found in the hypothalamus and nucleus accumbens
(Thim et al., 1999
) and based on preliminary data in feeding studies
demonstrating a potency difference (A.W. Bannon, unpublished
observations). The behavioral assays used were food intake in
fasted animals, open field locomotor activity, hot-plate, acoustic
startle response (ASR), and prepulse inhibition (PPI) of acoustic startle.
| |
Materials and Methods |
|---|
|
|
|---|
Peptides
CART peptides were obtained by chemical synthesis at Amgen
Boulder Inc (Longmont, CO) (Dodson et al., 1999
). The sequence for
rCART 42-89 is IPIYEKKYGQVPM-CDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL and
for rCART 49-89 the sequence is
YGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL. Both peptides contain three
disulfide bonds with C1/C3, C2/C5, C4/C6 connectivity (Thim et al.,
1998
; M. A. Jarosinski, W. S. Dodson, T. J. Zamborelli,
B. J. Harding, D. M. Lenz, M. Haniu, and J. Douglass,
unpublished observations).
Synthesis.
Peptides were prepared at 0.1- or 0.2-mmol scale
on an ABI 431 or 433 synthesizer (Applied Biosystems, Foster City, CA)
by using Fmoc/OtBu protection strategy with both 1.0 mmol of
N,N'-dicyclohexylcarbodiimide or
O-benzotriazole-N,N,N',N'-tetramethyluroniumhexafluorophosphate activation and Fmoc-Leu-Wang resin as the solid support. Removal of the
-amino Fmoc was with 20% piperidine in
N-methylpyrrolidone.
Purification. Crude peptide and HPLC fractions were analyzed by analytical RP-HPLC with a Vydac C4 column (Vydac, Hesperia, CA) with a linear gradient of 20 to 40% acetonitrile (ACN) in 0.1% aqueous TFA over 25 min with a flow rate of 1 ml/min. Large-scale RP-HPLC was done with a Vydac 218TP C18 column (Vydac) by using a linear gradient of 10 to 70% ACN in 0.1% aqueous TFA over 60 min with a flow rate of 7 ml/min.
Mass Spectral Analysis. HPLC fractions were analyzed by flow injection with an API 1 electrospray-mass spectrometry (PerSeptive Biosystems, Framingham, MA). Liquid chromatography-mass spectrometry was done with an API 150 (PerSeptive Biosystems) in conjunction with Waters Integrity HPLC system (Waters Corporation, Milford, MA) by using YMC ODS-AQ C18 column, with a linear gradient of 5 to 55% ACN in 0.1% aqueous TFA over 10 min with a flow rate of 0.5 ml/min. Amino acid analysis was performed with ABI 420A derivatizer (Applied Biosystems) with a 130A separation system. rCART peptides were manually hydrolyzed in a vacuo by using 6 N HCl at 150°C for 60 min. RP-HPLC was performed on a Brownlee PTC column (Applied Biosystems) with a linear gradient of 2 to 11% ACN in water over 4 min, 11 to 27% over 6 min, and then 27 to 47% over 10 min.
Equilibrium Refolding.
For refolding, 2.0 µmol of fully
reduced rCART peptides was dissolved in 10 ml of 50 mM Tris, 1 mM EDTA,
and redox reagents 1 mM reduced glutathione/1 mM oxidized glutathione
at pH 8.0. The reaction mixture was stirred at room temperature for
48 h then purified by preparative RP-HPLC, making sure the refold
buffer was acidified. Disulfide mapping confirms connectivity (M. A. Jarosinski, W. S. Dodson, T. J. Zamborelli, B. J. Harding, D. M. Lenz, M. Haniu, and J. Douglass, unpublished
observations) as previously reported (Thim et al., 1998
).
Animals
Male 129svimj mice 8 to 12 weeks of age were obtained from the Jackson Laboratories (Bar Harbor, ME). This strain was chosen based on previous experience where stable behavioral performance was found in the behavioral assays (e.g., prepulse inhibition). Animals were group housed (8-10/cage) and allowed at least a 7-day acclimation period to the American Association for the Accreditation of Laboratory Animal Care-approved animal facility at Amgen Inc. (Thousand Oaks, CA) before experiments. Mice were kept on a 12-h light/dark cycle with food and water available ad libitum at all times before the start of experiments. All experiments were conducted under protocols approved by Amgen's Institutional Animal Care and Use Committee and all studies were conducted during the light phase. Also, independent groups of animals were used for each experiment and for the testing of each peptide (i.e., animals were only used once).
Peptide Dosing
Mice were dosed using a free-hand i.c.v. (i.e., third ventricle) dosing technique. Briefly, mice were fully anesthetized (i.e., nonresponsive to tail pinch) using isoflurane. The injection site was determined by forming an equilateral triangle with the distance between the eyes as the base and the midline of the skull as the apex. A 25-µl Hamilton syringe was fitted with a 27-gauge needle and a plastic guide was placed on the needle to allow only 3 mm to penetrate the skull. While holding the syringe perpendicular to skull, the mouse was injected at the apex with 5 µl of solution and the needle was held in place for 10 s to prevent reflux. Mice were allowed 30 min of recovery before the start of testing in behavioral tests, unless otherwise noted. All peptides were diluted in sterile water and sterile water served as the vehicle (control). Control studies with dye were conducted to ensure the accuracy of injection. In these studies, the dye stayed confined to the ventricle system of the mouse (data not shown).
Open Field Locomotor Activity
Open field chambers (Hamilton-Kinder, San Diego, CA) were constructed of clear Plexiglas, with a base of 40.6 cm × 40.6 cm, and walls at a height of 38.1 cm. Location and ambulation were measured by infrared photobeam breaks. A 16 × 16 beam grid forms the first row at a height of approximately 3 cm from the floor. A second row of 16 photobeams in the x direction was located at a height of approximately 6.4 cm from the floor. The MotorMonitor software (Hamilton-Kinder) measures multiple endpoints, but for this study fine movements and total distance were used for statistical analysis. Fine movements were computed as all nonambulatory movements except rearing. Total distance (i.e., ambulation) was computed as distance traveled in the apparatus.
Fasting Studies
A single study was conducted with both peptides. The doses of CART 42-89 tested were 0.05, 0.1, and 0.5 µg i.c.v. The doses of CART 49-89 tested were 0.01, 0.05, and 0.1 µg i.c.v. These doses were based on data from preliminary studies indicating that at higher doses, there were gross motor disturbances that could disrupt the animals' ability to eat. Group-housed mice were deprived of food for approximately 20 h (i.e., overnight). The next day, animals were dosed with vehicle or peptide. After dosing, animals were placed in individual cages and a preweighted quantity of food was placed in the cage. Food intake measures were recorded 1, 2, 4, and 24 h after dosing.
Hot-Plate
A 30 cm × 30 cm hot-plate analgesia meter (Columbus Instruments, Columbus, OH) set at 55°C was used for testing. The endpoint was the latency(ies) to front paw lick, or until 25 s had elapsed, after which the animals were immediately removed from the plate. Testing began 45 min after treatment with peptides.
Acoustic Startle and Prepulse Inhibition
Acoustic startle was measured using four startle chambers
(StartleMonitor System; Hamilton-Kinder). The procedure used for testing was modified from Ralph et al. (1999)
. Mice were placed in a
9 × 4 × 4 cm Plexiglas holder located in a dark,
sound-attenuated, and ventilated startle chamber for a 5-min
acclimation period with exposure to a 65-dB background noise, which
continued throughout the session. A loudspeaker located 23 cm directly
above the animal holder produced the background noise and acoustic
stimuli. After the acclimation period, mice were exposed to five trial
types: a PULSE-ALONE trial consisting of a 120-dB, 40-ms pulse; a
PREPULSE + PULSE trial consisting of a 20-ms prepulse with an intensity of either 4, 8, or 16 dB above background noise, followed 100 ms later
by the 120-dB, 40-ms pulse; and a NO STIMULATION trial consisting of
the 65-dB background noise only. The session began and ended with five
PULSE-ALONE trials, between which all trials were presented 10 times in
a pseudorandom order with intertrial intervals ranging from 12 to
30 s (15-s average). Startle analyses: PPI was calculated as a
percentage score for each prepulse trial type: % PPI = 100
{[(PREPULSE + PULSE startle response)/PULSE ALONE startle
response)] × 100}. Startle magnitude was measured by a
piezoelectric accelerometer located beneath the animal holder. Beginning at stimulus onset, sixty-five 1-ms readings were digitized and recorded by PC-interfaced system software. Sound levels were calibrated using a Radio Shack sound level meter #33-2055 on slow response "A" weighting. Startle chamber sensitivity was calibrated using a pulse calibrator (Newtonbrator; Hamilton-Kinder).
Statistical Analysis
Data were analyzed using Statview (Abacus Concepts, Berkeley, CA). For the open field locomotor activity data, acoustic startle response, and hot-plate data, one-way ANOVA was used to analyze the data followed by post hoc tests (when appropriate) by using Fisher's protected least significant difference test. Each peptide was analyzed independently. For the prepulse inhibition data, dose (between subject) and prepulse level (within subject) were used as factors and analyzed with ANOVA for each peptide. Subsequent one-way ANOVA was performed on data at each prepulse level followed by Fisher's protected least significant difference test when appropriate. In all cases, the criterion for statistical significance was p < 0.05.
| |
Results |
|---|
|
|
|---|
Open Field Locomotor Activity.
These studies were conducted to
provide a quantification of possible effects of the CART peptides on
gross motor function. This was important because all of the behavioral
measures examined in this study, including feeding behavior, depend
upon motor function. Fine movements and total distance parameters were
measured in the open field locomotor activity monitors and these data
are presented in Fig. 1, A and B,
respectively. Data represent the mean ± S.E.M. activity for a 1-h
session and each peptide was tested separately. For fine movements,
there was not a significant effect following treatment with either CART
42-89 [F(3,27) = 1.224, p = 0.32] or
CART 49-89 [F(3,28) = 0.055, p = 0.98] although the lower doses of CART 42-89 (0.005 and 0.05 µg
i.c.v.) tended to increase this parameter. Statistically, total
distance was not affected by treatment with CART 42-89
[F(3,27) = 1.408, p = 0.26] although
there was a trend for an increase in total distance at the 0.05-µg
i.c.v. dose. Also, no significant effects on total distance were found
after treatment with CART 49-89 [F(3,28) = 0.368, p = 0.77]. Overall, at the doses tested (0.005-0.5
µg i.c.v.) there were not statistically significant effects of CART
peptides on any of the measures taken from the open field locomotor
activity assay. This dose range was chosen because it covers the doses of CART peptides used in the subsequent behavioral assays. It should be
noted that control experiments conducted with nonanesthetized compared
with anesthetized mice indicated no effect of anesthesia on these
locomotor parameters (i.e., mean of 1-h session; data not shown).
|
Effects CART Peptides on Fast-Induced Feeding.
The effects of
the CART peptides on fast-induced food intake are presented in Table
1. Overall, there were significant
effects of peptide treatment at 1 h [F(6,49) = 8.741, p < 0.001], 2 h [F(6,49) = 7.727, p < 0.0001], and 4 h
[F(6,49) = 3.306, p = 0.0082] but not
at 24 h [F(6,49) = 1.463, p = 0.21]. With CART 42-89 treatment, significant reductions of 73%
(p = 0.0007) and 60% (p < 0.0001) relative to vehicle-treated animals were observed at 1 and 2 h post-treatment. At 4 h post-treatment, food intake was decreased 43% (p = 0.08) with CART 42-89 treatment, but this
was not a statistically significant effect. After treatment with CART
49-89 (0.1 µg i.c.v.) significant inhibition of food intake was
observed at 1, 2, and 4 h after treatment with decreases of 80%
(p = 0.0002), 60% (p < 0.0001), and
43% (p = 0.02), respectively. Overall, only the high
doses of these CART peptides significantly inhibited food intake and
the minimally effective dose of CART 42-89 (0.5 µg i.c.v.) was
5-fold greater than that of CART 49-89 (0.1 µg i.c.v.).
|
Effects of CART Peptides on Thermal Nociception (Hot-Plate).
Hot-plate data for CART 42-89 and CART 49-89 are presented in Fig.
2. With CART 42-89 there was an overall
effect of dose [F(3,28) = 10.363, p < 0.0001]. Post hoc analysis indicated a significant increase in latency
to respond at 0.5 µg (i.c.v.) 42-89 (p < 0.0001).
An overall significant effect of dose was found with CART 49-89 on paw
lick latency [F(3,27) = 3.476, p = 0.03]. Post hoc analysis indicated a significant increase in paw lick
latency with 0.1 µg (i.c.v.) CART 49-89. Based on these data, the
dose of CART 42-89 that significantly increased paw lick latency (0.5 µg i.c.v.) was 5-fold greater than that of CART 49-89 (0.1 µg
i.c.v.).
|
Acoustic Startle Response.
Built into a paradigm of prepulse
inhibition of acoustic startle were pulse alone trials (120 dB) (under
Materials and Methods). These pulse alone trials were used
to compute the ASR. With CART 42-89 (Fig.
3A), there was an overall effect of dose
[F(2,45) = 8.941, p = 0.005] on ASR.
Post hoc analysis indicated that 0.1 and 0.5 µg i.c.v. CART 42-89
significantly decreased ASR by 37% (p = 0.005) and
52% (p = 0.002), respectively. Interestingly, with
CART 49-89 (Fig. 3B), no effect on ASR was observed
[F(2,44) = 0.217, p = 0.8] with the
doses tested (0.05 and 0.1 µg i.c.v.).
|
Prepulse Inhibition.
In the PPI paradigm, three
different prepulse levels were used: 1) 4 dB above background (pp4), 2)
8 dB above background (pp8), and 3) 16 dB above background (pp16). In a
separate experiment with CART 42-89 (Fig.
4A) and CART 49-89 (Fig. 4B), prepulse
level-dependent inhibition was observed in vehicle-treated animals in
both experiments. For CART 42-89, there was not a significant overall
effect of treatment [F(2,45) = 2.386, p = 0.1] but there was a significant effect of the
within-subjects measure of prepulse level [F(2,90) = 241.409, p < 0.0001] and a significant interaction of
prepulse level and treatment [F(4,90) = 3.928, p = 0.006]. At the pp8 level, CART 42-89 at the 0.5 µg i.c.v. dose produced a significant 58% increase
(p = 0.004). With CART 49-89, an overall significant effect of treatment [F(2,44) = 4.880, p = 0.0122] and a significant effect of the
within-subjects measure of prepulse level [F(2,88) = 323.803, p < 0.0001] but no interaction
[F(4,88) = 0.466, p = 0.76] was
found. At pp4, post hoc analysis indicated significant increases in PPI
of 96% (p = 0.03) and 115% (p = 0.01)
with 0.05 and 0.1 µg i.c.v. CART 49-89, respectively. At pp8, post
hoc analysis indicated significant increases in PPI of
43% (p = 0.03) and 47% (p = 0.02)
with 0.05 and 0.1 µg i.c.v. CART 49-89, respectively. At pp16, post
hoc analysis indicated significant increases in PPI of 22%
(p = 0.01) and 17% (p = 0.04) with
0.05 and 0.1 µg i.c.v. CART 49-89, respectively.
|
| |
Discussion |
|---|
|
|
|---|
Most of the published in vivo work with CART peptides has reported
on CART 42-89 with the focus on feeding behavior (Kristensen et al.,
1998
; Vrang et al., 1999
). Data from the current study suggest that
CART peptides have a diverse spectrum of biological activity and two
biologically relevant forms of CART peptide can be distinguished in
vivo based on potency or activity (i.e., ASR). There is one published
study that compares the effects of i.c.v. administration of CART
peptides on food intake in fasted mice with peptides corresponding to
CART 42-89 and CART 49-89 (Thim et al., 1998
). In that study, CART
42-89 appears to be more potent and efficacious than CART 49-89.
Those results are in contrast to the current study in which CART 42-89
appears to be 5-fold less potent than CART 49-89 with respect to
effects on food intake. However, comparison of the two studies is
difficult because of differences in the experimental protocols (e.g.,
method of CART peptide production and strain of animals used). Overall,
the data from the present study provide evidence across multiple models that the two forms of CART peptides tested can be differentiated.
In the first published report describing the effects of CART peptide
injection (CART 42-89) in rats there was a note of "motor effects"
at doses that affected food intake, but additional data were presented
suggesting the motor effect was not underlying the effect on food
intake (Kristensen et al., 1998
). We have previously monitored
home-cage activity concurrently with feeding (A.W. Bannon, unpublished
observations). In those studies, there was a trend for CART
peptides to decrease locomotor activity at doses that inhibited food
intake but the duration of the effect on food intake was longer (4 h)
than that on locomotor activity (1 h). In the current study, CART
peptide treatment had no statistically significant effects on
parameters taken from a 1-h session in the open field locomotor assay.
The lack of effect on motor activity in this experiment could be due to
the timing. For example, it is possible that motor effects occurred
immediately after injection and this effect would not have been found
because testing began 30 min after injection. Also, there was a high
degree of variability that could underlie the lack of observing an
effect. However, the important point in the current study was that
gross motor impairment was not observed using doses of CART peptides
examined in subsequent behavioral assays. This was an important finding because all of the behavioral assays used in this study depend upon a
motor response.
In this study, only the highest dose of CART 42-89 (0.5 µg i.c.v.)
and CART 49-89 (0.1 µg i.c.v.) decreased food intake with no
evidence of dose dependence. As noted above, gross motor impairment was
not observed at these doses, but these results may bring into question
the specificity of the anorectic effects of these peptides. A recent
article by Aja et al. (2001)
that used some microstructure analysis
suggests altered oral motor function and/or changes in perception of
palatability could contribute to the anorectic action of CART peptide
(e.g., 42-89) in rats. As suggested by those authors, further
microstructure analysis of feeding may help clarify the nature of the
anorectic effect of CART peptides.
One novel finding in the current study was that CART peptides produced
a significant antinociceptive effect in the hot-plate assay and there
was a potency difference between the two peptides. The antinociceptive
effect in the present study after i.c.v. dosing of CART peptides was in
contrast to a hyperalgesic effect observed after intrathecal dosing of
CART peptide corresponding to CART 42-89 (Ohsawa et al., 2000
).
However, differences in route of administration could contribute to the
differences observed behaviorally. The mechanism(s) for CART peptides
modulating nociception is unclear, but CART peptide positive
immunoreactivity has been found in areas associated with the modulation
of nociception such as the periaquaductal gray, the dorsal raphe
nucleus, the locus ceruleus, and the spinal cord (Douglass et al.,
1995
; Koylu et al., 1998
). Thus, CART peptides may modulate release of
neurotransmitters involved with pain processing and/or transmission.
Further study into the involvement of CART peptides in nociception is
needed to confirm these initial findings. Regardless, as observed with
feeding, in the hot-plate model CART 42-89 was 5-fold less potent than
CART 49-89.
Another novel finding in this study was that CART 42-89 (0.1 and 0.5 µg i.c.v.) decreased ASR but at the doses tested, CART 49-89 (0.05 and 0.1 µg i.c.v.) had no effect on ASR. This was an interesting
finding because it was the only example of CART 42-89 having an effect
that was not observed with CART 49-89, at least at the doses tested.
ASR is a simple reflexive response that is subject to different forms
of plasticity. For example, there have been demonstrations that
secondary reinforcers may diminish the ASR (Koch et al., 1996
) and
aversive stimuli can increase ASR (Davis et al., 1993
). CART was
originally discovered as an up-regulated mRNA in striatum after acute
treatment with cocaine and amphetamine, and there has been previous
speculation about its potential role in underlying the addictive
properties of these stimulants (Douglass et al., 1995
; Hurd et al.,
1999
). In mice, amphetamine administration has been shown to decrease ASR (Dulawa and Geyer, 1996
; Ralph et al., 1999
). One interpretation for the current finding of CART 42-89 decreasing ASR was that this
peptide produced a reinforcing effect. This interpretation is
consistent with a finding by Kimmel et al. (2000)
in that in rats
intraventral tegmental injection of CART peptide (e.g., 42-89) produced significant place preference.
Interestingly, treatment with CART 42-89 tended to enhance PPI, and a
similar but more robust effect was observed with CART 49-89. Thus,
despite different effects on ASR, these peptides both appear to enhance
PPI. PPI is a measure of sensorimotor gating. Statistically, only at
the prepulse level of 4 dB above background (pp4) was the effect of
CART 42-89 (0.5 µg i.c.v.) significant and this dose was 10-fold
greater than the dose of CART 49-89 (0.05 µg i.c.v.) observed to
enhance PPI at the same prepulse level. This difference in potency
between the peptides was consistent with the effects observed on
feeding and in the hot-plate assay. The finding that CART peptides
modulated PPI was not too surprising. This was because the brain areas
thought to mediate PPI such as the ventral tegmental area, nucleus
accumbens, and ventral pallidum (Nauta et al., 1978
; Swerdlow et al.,
1990
, 1992
; Swerdlow and Geyer, 1993
; Kodsi and Swerdlow, 1995
) are
positive for CART mRNA and peptide immunoreactivity (Douglass et al.,
1995
; Couceyro et al., 1997
; Koylu et al., 1998
). However, the apparent
enhancement of PPI could be considered surprising. If anything, one may
have predicted that increasing brain CART peptide levels would possibly disrupt PPI. This was based on the findings that amphetamine, an agent
that increases CART mRNA levels in the striatum, also disrupts PPI in
rats and mice (Mansbach et al., 1988
; Dulawa and Geyer, 1996
).
Disruption of PPI has been found in certain psychiatric disorders such
as schizophrenia. It was tempting to speculate that enhancement of PPI
in normal animals by CART peptide treatment represented a potential
novel target for disorders such as schizophrenia. However, it should be
noted that not all known effective antipsychotic drugs enhance PPI in
normal animals and some drugs that are not effective in schizophrenia
do enhance PPI in normal animals (Depoortere et al., 1997
). Thus, there
seems to be little predictive value of enhancement of PPI in normal
animals for identifying potential schizophrenia treatments. It will be
interesting to further study the effects of CART peptides in models
relevant for neuropsychiatric diseases.
In summary, this work demonstrates multiple behavioral actions of CART
peptides in mice after i.c.v. administration and that two biologically
relevant forms of CART can be differentiated based on minimally
effective dose in several assays as well as activity (i.e., effect on
acoustic startle response). Recently, NMR spectroscopy has determined
the three-dimensional structure of the disulfide-linked C-terminal part
of human CART molecules corresponding to rCART 42-89 and rCART 49-89
(Ludvigsen et al., 2001
). The specific disulfide-binding pattern
between the six cysteine residues determines the major structural
component of the molecule, a compact cystine knot. In contrast, the
N-terminal residues have a comparatively disordered structure. Thus,
these CART peptides are predicted to have a "ball and chain"
structure (Thim et al., 1998
), with the length of the N-terminal chain
portion possibly serving to structurally distinguish the two CART
peptides tested here. The fact that these two CART peptides can now be differentiated both structurally and functionally is suggestive of
multiple CART receptors. Obviously, identification of mammalian CART
receptors will be critical in further elucidating the function of these
putative neuropeptides. The results from the current study suggest that
CART 42-89 and CART 49-89 may be useful tools for identifying CART
receptors, and that CART is a potentially meaningful target for the
modulation of multiple central nervous system-mediated behaviors.
| |
Footnotes |
|---|
Accepted for publication August 23, 2001.
Received for publication July 13, 2001.
Address correspondence to: Dr. Anthony Bannon, Amgen Inc., One Amgen Center Dr., M/S 29-1-A, Thousand Oaks, CA 91320-1789. E-mail: abannon{at}amgen.com
| |
Abbreviations |
|---|
CART, cocaine- and amphetamine-regulated transcript; ASR, acoustic startle response; PPI, prepulse inhibition; HPLC, high-performance liquid chromatography; RP-HPLC, reverse phase-high-performance liquid chromatography; ACN, acetonitrile; TFA, trifluoroacetic acid; ANOVA, analysis of variance; pp4, prepulse level 4 dB above background; pp8, prepulse level 8 dB above background; pp16, prepulse level 16 dB above background.
| |
References |
|---|
|
|
|---|
This article has been cited by other articles:
![]() |
J. D. Ahn, B. Dubern, C. Lubrano-Berthelier, K. Clement, and G. Karsenty Cart Overexpression Is the Only Identifiable Cause of High Bone Mass in Melanocortin 4 Receptor Deficiency Endocrinology, July 1, 2006; 147(7): 3196 - 3202. [Abstract] [Full Text] [PDF] |
||||
![]() |
N. Wierup, M. Bjorkqvist, M. J. Kuhar, H. Mulder, and F. Sundler CART Regulates Islet Hormone Secretion and Is Expressed in the {beta}-Cells of Type 2 Diabetic Rats Diabetes, February 1, 2006; 55(2): 305 - 311. [Abstract] [Full Text] [PDF] |
||||
![]() |
P. R. Couceyro, C. Evans, A. McKinzie, D. Mitchell, M. Dube, L. Hagshenas, F. J. White, J. Douglass, W. G. Richards, and A. W. Bannon Cocaine- and Amphetamine-Regulated Transcript (CART) Peptides Modulate the Locomotor and Motivational Properties of Psychostimulants J. Pharmacol. Exp. Ther., December 1, 2005; 315(3): 1091 - 1100. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. N. Jaworski, M. A. Kozel, K. B. Philpot, and M. J. Kuhar Intra-Accumbal Injection of CART (Cocaine-Amphetamine Regulated Transcript) Peptide Reduces Cocaine-Induced Locomotor Activity J. Pharmacol. Exp. Ther., December 1, 2003; 307(3): 1038 - 1044. [Abstract] [Full Text] [PDF] |
||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||