QUICK SEARCH:   [advanced] Author: Keyword(s): Year:  Vol:  Page:

This Article Full Text Full Text (PDF) All Versions of this Article: jpet.106.112276v1 320/2/900    most recent Submit a response Alert me when this article is cited Alert me when eLetters are posted Alert me if a correction is posted Citation Map Services Similar articles in this journal Similar articles in PubMed Alert me to new issues of the journal Download to citation manager Citing Articles Citing Articles via HighWire Citing Articles via Google Scholar Google Scholar Articles by Pan, C. Q. Articles by Whelan, J. P. Search for Related Content PubMed PubMed Citation Articles by Pan, C. Q. Articles by Whelan, J. P.

ENDOCRINE AND DIABETES

Engineering Novel VPAC2-Selective Agonists with Improved Stability and Glucose-Lowering Activity in Vivo

Bayer Healthcare, Biotechnology, Berkeley, California (C.Q.P., I.T., W.W., M.D., W.F., S.L.Y., S.R., Y.J.W.); and Bayer Healthcare, Pharmaceuticals, Department of Metabolic Disease Research, West Haven, Connecticut (F.L., Y.L., T.H.C., J.P.W.)

A previously described VPAC2-selective agonist, BAY 55-9837 (peptide HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY), had several limitations with respect to its potential as an insulin secretagogue for the treatment of type 2 diabetes. These limitations were primarily poor stability in aqueous buffer and short duration of action in vivo. In this report, we describe a series of novel analogs of BAY 55-9837 that were designed around the likely degradation mechanisms and structure-activity relationship of this peptide with a view to overcoming its limitations. These analogs were tested for improved liquid stability and retention of VPAC2-selective binding and activation, as well as prolonged activity in vivo. Although several degradation mechanisms were possible based on the degradation pattern, it was determined that deamidation at the two asparagines (N9 and N28) was the major instability determinant. Changing these two asparagines to glutamines did not negatively affect VPAC2-selective binding and activation. The double glutamine mutein analog, BAY(Q9Q28), retained full VPAC2 activity and selectivity while displaying no significant degradation when stored at 40°C for 4 weeks. This is in contrast to BAY 55-9837, which showed greater than 80% degradation when stored at 40°C for 2 weeks. A cysteine was added to the C terminus of BAY(Q9Q28), followed by site-specific cysteine conjugation with a 22- or 43-kDa polyethylene glycol (PEG) to yield BAY(Q9Q28C32)PEG22 or BAY(Q9Q28C32)PEG43, respectively. These PEGylated peptides retain the ability to selectively bind and activate the VPAC2 receptor and have prolonged glucose-lowering activity in vivo.

Address correspondence to: James P. Whelan, Department of Metabolic Disease Research, Bayer HealthCare, Pharmaceuticals, West Haven, CT 06516. E-mail: james.whelan.b{at}bayer.com

This article has been cited by other articles:

				M.L.H.J. Hermes, M. Kolaj, P. Doroshenko, E. Coderre, and L. P. Renaud Effects of VPAC2 Receptor Activation on Membrane Excitability and GABAergic Transmission in Subparaventricular Zone Neurons Targeted by Suprachiasmatic Nucleus J Neurophysiol, September 1, 2009; 102(3): 1834 - 1842. [Abstract] [Full Text] [PDF]

				G. Zhang, B. Han, X. Lin, X. Wu, and H. Yan Modification of Antimicrobial Peptide with Low Molar Mass Poly(ethylene glycol) J. Biochem., December 1, 2008; 144(6): 781 - 788. [Abstract] [Full Text] [PDF]